Shine n Jam Ampro Pro Styl Shine Enhancing Jar Hair Styling Gel with Olive Oil & Silk Protein, 8 oz
Shine 'n Jam

Shine n Jam Ampro Pro Styl Shine Enhancing Jar Hair Styling Gel with Olive Oil & Silk Protein, 8 oz

BHD 4.80
In StockBHBH
Title (1 variants)

Default Title

SKU: 77312412821

BHD 4.80

In stock

View Now

Description

Shine 'n Jam® silk edges extra firm hold is a non-greasy, conditioning gel designed to smooth hair edges while adding a sleek, finished look. This unique formula is enhanced with silk protein to help strengthen delicate tresses around the hairline while emollient rich olive oil keeps hair shiny and looking healthy as your manage your styles. Powerful holding ingredients provide an extra firm hold for even the most resistant hair texture without allowing hair to harden. Great for smoothing down edges, ponytails and up-dos. Free of alcohol, wax, parabens, dyes and petrolatum. Works well on virgin or chemically treated hair.

Product Information

BrandShine 'n Jam
CategoryConditioner
MPN / SKU77312412821
Item Group7536880320670
CurrencyBHD
CountryBH

Ships to (199 countries)

ACACADADAEAEALALAMAMAOAOARARATATAUAUAXAXAZAZBABABDBDBEBEBFBFBGBGBHBHBIBIBJBJBNBNBOBOBRBRBSBSBTBTBWBWBYBYCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCXCXCYCYCZCZDEDEDJDJDKDKDMDMDZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGEGEGFGFGGGGGHGHGIGIGMGMGNGNGQGQGRGRGWGWHKHKHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIOIQIQISISITITJEJEJMJMJOJOJPJPKEKEKGKGKHKHKIKIKMKMKRKRKWKWKZKZLALALBLBLILI