Shea Moisture 100% Extra Virgin Coconut Oil - 15 fl ozOut of stock
Shea Moisture

Shea Moisture 100% Extra Virgin Coconut Oil - 15 fl oz

BHD 10.20
Out of StockBHBH
Title (1 variants)

Default Title

SKU: 764302290131

BHD 10.20

Out of stock

View Now

Description

Description 100% Extra Virgin Coconut Oil is rich in antioxidant Vitamin E, that nourishes and protects skin and hair. Helps to soften and restore skin and hair. Natural Triglycerides help retain moisture and keep skin smooth to the touch, while conditioning properties soften hair for easy styling. An all-over, multi-benefit product that helps with moisture retention, smoothing and protecting. Fast absorbing body Coconut Oil can be used on hair, face, body, hands and feet without clogging pores or leaving a greasy residue. Perfect for softening rough elbows, hands, cuticles, knees, toes and adding moisture to dry hair. Revitalize skin with a healthy glow, helps to take off makeup as well. Can be used as a body oil, or body moisturizer for dry skin oil. Great for all skin types, including dry and extra dry skin and hair. Coconut Oil for skin, envelops you in a layer of hydration. Perfect for use as an after shower oil all over skin and hair. Perfect body oil for dry skin. Use sparingly. A little goes a long way. Natural coconut oil solidifies below normal room temperature but will melt in the warmth of your hands. Good for 12 months once opened. This multi-purpose coconut oil helps hydrate and moisturize all skin and hair types. Highlights Soften & Restore hair and skin with this coconut oil - the perfect body oil for dry skin. 100% Coconut Oil hydrates and softens even the driest skin and hair. An all-over, multi-benefit product that helps with moisture retention, smoothing and protecting. Fast absorbing Coconut Oil can be used on hair, face, hands, body and feet without clogging pores or leaving a greasy residue. A wonderful body moisturizer. This coconut oil can also be used as a moisturizing makeup remover or a body moisturizer. Revitalize skin and hair with a healthy glow. Made with 100% Coconut Oil SheaMoisture's coconut oil is a pure skin oil that has no sulfates, no parabens, no phthalates, no propylene glycol, no mineral oil, no animal testing and no petrole

Product Information

BrandShea Moisture
Categoryoil
MPN / SKU764302290131
Item Group6701727613086
CurrencyBHD
CountryBH

Ships to (199 countries)

ACACADADAEAEALALAMAMAOAOARARATATAUAUAXAXAZAZBABABDBDBEBEBFBFBGBGBHBHBIBIBJBJBNBNBOBOBRBRBSBSBTBTBWBWBYBYCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCXCXCYCYCZCZDEDEDJDJDKDKDMDMDZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGEGEGFGFGGGGGHGHGIGIGMGMGNGNGQGQGRGRGWGWHKHKHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIOIQIQISISITITJEJEJMJMJOJOJPJPKEKEKGKGKHKHKIKIKMKMKRKRKWKWKZKZLALALBLBLILI
Shea Moisture 100% Extra Virgin Coconut Oil - 15 fl oz — Bobby