Shea Moisture Coconut Hibiscus collectionOut of stock-31% off
Shea Moisture

Shea Moisture Coconut Hibiscus collection

BHD 27.60BHD 40.20Save BHD 12.60
Out of StockBHBH
Title (1 variants)

Default Title

SKU: Set

BHD 27.60

Out of stock

View Now

Description

Shea Moisture Curl Smoothie - Coconut & Hibiscus Curl Enhancing Smoothie Treat your thirsty locks to ultra-luxurious hydration with SheaMoisture Curl Enhancing Smoothie in our much-loved Coconut & Hibiscus formula. Considered by many to be one of the best curl- defining products for hair that's naturally curly or coily, you can use it on damp or dry hair to enhance all of your hair or just the edges and ends. And if you're into braids, twist-outs or wash n' go, this smoothie treatment is everything! Our Curl Enhancing Smoothie, enriched with Silk Protein and Neem Oil, defines curls, reduces frizz and smooths hair for a soft, silky feel. Coconut and Neem Oils also help restore moisture to dry strands while creating brilliant shine. Nutrient rich vegetable butters condition hair without weighing it down for bouncy, healthy curls. A little bit of this smoothie goes a long way. Shampoo Conditioner Curl Smoothie Curling Gel

Product Information

BrandShea Moisture
CategoryCombo
MPN / SKUSet
Item Group6703023489182
CurrencyBHD
CountryBH

Ships to (199 countries)

ACACADADAEAEALALAMAMAOAOARARATATAUAUAXAXAZAZBABABDBDBEBEBFBFBGBGBHBHBIBIBJBJBNBNBOBOBRBRBSBSBTBTBWBWBYBYCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCXCXCYCYCZCZDEDEDJDJDKDKDMDMDZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGEGEGFGFGGGGGHGHGIGIGMGMGNGNGQGQGRGRGWGWHKHKHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIOIQIQISISITITJEJEJMJMJOJOJPJPKEKEKGKGKHKHKIKIKMKMKRKRKWKWKZKZLALALBLBLILI