Black crotchless bodysuit with hearts - Bring Gifts
COAXcopenhagen.com

Black crotchless bodysuit with hearts - Bring Gifts

€26.00
In StockDKDK
Size (1 variants)

One Size

SKU: 89319-black

€26.00

In stock

View Now

Description

Crotchless Bodysuit Lingerie with Hearts Bring sweet seduction into the spotlight with this sexy crotchless bodysuit in soft, stretchy heart-patterned mesh. With its halter neck straps and curve-hugging fit, it is the perfect piece for teasing, tempting, and taking control. The open crotch turns up the heat, while the all-over heart motif keeps it playful and flirty. Whether you are planning a surprise or just dressing to feel irresistible, this one is guaranteed to make sparks fly. Romance with a naughty twist This bodysuit blends sheer coverage with bold detail - from its delicate pattern to its daring open design. It is ultra-stretchy, ultra-revealing, and ultra-fun to wear. Slip it on and let the heartbeats race. DETAILS & FEATURES All-over heart pattern in dual net Crotchless design Thin halter neck straps Soft & stretchable for a snug fit Made of 92% nylon, 8% spandex

Product Information

BrandCOAXcopenhagen.com
CategoryBodysuit:Crotchless
MPN / SKU89319-black
Item Group14937464897862
CurrencyEUR
CountryDK

Ships to (235 countries)

ADADAEAEAFAFAGAGAIAIALALAMAMAOAOARARATATAUAUAWAWAXAXAZAZBABABBBBBDBDBEBEBFBFBGBGBHBHBIBIBJBJBLBLBMBMBNBNBOBOBQBQBRBRBSBSBTBTBWBWBYBYBZBZCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCWCWCXCXCYCYCZCZDEDEDJDJDKDKDMDMDODODZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGDGDGEGEGFGFGGGGGHGHGIGIGLGLGMGMGNGNGPGPGQGQGRGRGSGSGTGTGWGWGYGYHKHKHNHNHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIOIQIQ