Mielle Babassu Oil & Mint Deep Conditioner
Mielle

Mielle Babassu Oil & Mint Deep Conditioner

BHD 10.80
In StockBHBH
Title (1 variants)

Default Title

SKU: 854102006053

BHD 10.80

In stock

View Now

Description

Restore dry and damaged hair with this replenishing organic hair conditioner from Mielle! • Reduces frizz and flyaways • Infuses hair with protein and moisture • Made with certified organic ingredients Derived from an Amazonian palm fruit, babassu oil contains high concentrations of sterols and tocopherols to moisturize and improve hair and scalp. That’s why it’s one of the main ingredients of this organic hair conditioner. Our Babassu Oil & Mint Deep Conditioner is enriched with fatty acids and natural oils, as well as complex amino acids from wheat, soy, and other all-natural ingredients, to help hydrate and replenish your hair. Give your hair the care it deserves – order your Mielle Organics hair products today! 8 fl. oz. | Formulated for all hair types | Safe for color-treated hair | Not tested on animals t. ‰ª´Fair Trade Ingredient Ingredients Water/aqua/eau, behentrimonium methosulfate, cetearyl alcohol, cetylesters, *Orbignya oleifera (babassu) seed oil, Pyrus malus (apple) fruit extract, glycerin, sodium PCA, sodium lactate, arginine, aspartic acid, PCA, glycine, alanine, serine, valine, proline, threonine, isoleucine, histidine, phenylalanine, *Euterpe oleracea (acai) pulp oil, Pentaclethra macroloba (pracaxi) seed oil, *Rosmarinus officinalis (rosemary) leaf extract, *Helianthus annuus (sunflower) seed oil, *Lavandula angustifolia (Lavender) oil, *Pelargonium graveolens (Geranium) flower oil, Salvia officinalis (Sage) oil, Mentha piperita (peppermint) oil, Citrus paradise (Grapefruit) peel oil, Litsea cubeba fruit oil, Mentha Viridis (spearmint) leaf oil, isoamyl laurate, dehydroacetic acid, benzyl alcohol *CERTIFIED ORGANIC INGREDIENTS

Product Information

BrandMielle
CategoryHair Masque
MPN / SKU854102006053
Item Group7274891313310
CurrencyBHD
CountryBH

Ships to (199 countries)

ACACADADAEAEALALAMAMAOAOARARATATAUAUAXAXAZAZBABABDBDBEBEBFBFBGBGBHBHBIBIBJBJBNBNBOBOBRBRBSBSBTBTBWBWBYBYCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCXCXCYCYCZCZDEDEDJDJDKDKDMDMDZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGEGEGFGFGGGGGHGHGIGIGMGMGNGNGQGQGRGRGWGWHKHKHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIOIQIQISISITITJEJEJMJMJOJOJPJPKEKEKGKGKHKHKIKIKMKMKRKRKWKWKZKZLALALBLBLILI