Shea Moisture Moringa & Avocado Power Greens ConditionerOut of stock
Shea Moisture

Shea Moisture Moringa & Avocado Power Greens Conditioner

BHD 9.60
Out of StockBHBH
Size (1 variants)

13oz

SKU: 764302015086

BHD 9.60

Out of stock

View Now

Description

Full Product Description Moisturize, detangle, and soften hair to improve hair’s manageability. Designed to provide moisture to dry strands, while nourishing and softening hair from root to tip, making the detangling process seamless. Product Details SheaMoisture is dedicated to maintaining the accuracy of the ingredient lists on this website. However, because raw ingredients listings are subject to change due to INCI, we cannot guarantee that these lists are complete, up-to-date and/or error-free. For an accurate listing of ingredients in each product, please refer to your product packaging. Usage Instructions Apply to clean, wet hair. Gently comb through from roots to ends. Leave in for up to three minutes. Rinse. Ingredients Water, Glycerin (Vegetable), Cetearyl Alcohol, Stearyl Alcohol, Cetyl Alcohol, Butyrospermum Parkii (Shea) Butter*?, Isopropyl Myristate, Olea Europaea (Olive) Fruit Oil, Moringa Oleifera Seed Oil, Persea Gratissima (Avocado) Oil, Camellia Sinensis (Green Tea) Leaf Powder, Prunus Amygdalus Dulcis (Sweet Almond) Oil, Brassica Oleracea Acephala (Kale) Leaf Extract, Melia Azadirachta (Neem) Leaf Extract, Melia Azadirachta (Neem) Flower Extract, Chlorella Vulgaris Extract, Hydrolyzed Soy Protein, Hydrolyzed Rice Protein, Sodium Lauroyl Hydrolyzed Silk, Citrus Medica Limonum (Lemon) Juice, Tocopherol, Behentrimonium Chloride, Cetrimonium Chloride, Capryloyl Glycerin/Sebacic Acid Copolymer, Diheptyl Succinate, Glycine Soja (Soybean) Oil, Triethyl Citrate, Caprylyl Glycol, Benzoic Acid, Fragrance (Essential Oil Blend) *Certified Organic Ingredient ?Fair Trade Ingredient

Product Information

BrandShea Moisture
CategoryConditioner
MPN / SKU764302015086
Item Group6615861592222
CurrencyBHD
CountryBH

Ships to (199 countries)

ACACADADAEAEALALAMAMAOAOARARATATAUAUAXAXAZAZBABABDBDBEBEBFBFBGBGBHBHBIBIBJBJBNBNBOBOBRBRBSBSBTBTBWBWBYBYCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCXCXCYCYCZCZDEDEDJDJDKDKDMDMDZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGEGEGFGFGGGGGHGHGIGIGMGMGNGNGQGQGRGRGWGWHKHKHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIOIQIQISISITITJEJEJMJMJOJOJPJPKEKEKGKGKHKHKIKIKMKMKRKRKWKWKZKZLALALBLBLILI