Eco Styler Black Castor Oil & Flaxseed Gel
Ecoco

Eco Styler Black Castor Oil & Flaxseed Gel

BHD 4.80
In StockBHBH
Size (2 variants)

8oz

SKU: 748378004205

BHD 3.00

Out of stock

16oz

SKU: 748378004212

BHD 4.80

In stock

View Now

Description

Eco Style Black Castor and Flaxseed Oil styling gel helps to nourish, repair and grow hair. Wheat protein strengthens and protects hair. Like all of our styling gels, it is weightless and will leave our hair with a healthy shine and superior hold. FEATURES Shines, Smoothes and Conditions hair No flake, no tack, anti-itch UV Protection DIRECTIONS Apply to dry or wet hair. Work desired amount through hair and style. Ingredients: Standard Water, PolYgel HG, FD&C Yellow 5, Standard Water, Flamenco Super Pearl, Glycerine 99%, PVP K-90, Glycosperse L-20, Fragrange (Parfum), Suttocide A, TEA 99%, Dissolvine Na-X, Flaxseed Oil, Castor Oil

Product Information

BrandEcoco
CategoryStyling Gel
MPN / SKU748378004212
Item Group6128783884446
CurrencyBHD
CountryBH

Ships to (199 countries)

ACACADADAEAEALALAMAMAOAOARARATATAUAUAXAXAZAZBABABDBDBEBEBFBFBGBGBHBHBIBIBJBJBNBNBOBOBRBRBSBSBTBTBWBWBYBYCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCXCXCYCYCZCZDEDEDJDJDKDKDMDMDZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGEGEGFGFGGGGGHGHGIGIGMGMGNGNGQGQGRGRGWGWHKHKHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIOIQIQISISITITJEJEJMJMJOJOJPJPKEKEKGKGKHKHKIKIKMKMKRKRKWKWKZKZLALALBLBLILI
Eco Styler Black Castor Oil & Flaxseed Gel — Bobby