Eco styler ecoplex moisturizing leave in conditionerOut of stock
Ecoco

Eco styler ecoplex moisturizing leave in conditioner

BHD 5.40
Out of StockBHBH
Title (1 variants)

Default Title

SKU: 748378004885

BHD 5.40

Out of stock

View Now

Description

Description Eco Style Black Castor And Flaxseed Oil Leave In Conditioner, A luxuriously creamy, hydrating formula that eliminates frizz and leaves your hair glowing, softly scented, and super soft. Enriched with black castor and flaxseed oil and milk protein to strengthen, deeply condition, detangle and nourish your hair. Sulfate free, paraben free, mineral oil free, petrolatum free. Features & details Help eliminates frizz and leaves your hair glowing, softly scented, and super soft. For dry or damaged hair. Promotes hair growth.

Product Information

BrandEcoco
CategoryLeave in
MPN / SKU748378004885
Item Group6721866170526
CurrencyBHD
CountryBH

Ships to (199 countries)

ACACADADAEAEALALAMAMAOAOARARATATAUAUAXAXAZAZBABABDBDBEBEBFBFBGBGBHBHBIBIBJBJBNBNBOBOBRBRBSBSBTBTBWBWBYBYCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCXCXCYCYCZCZDEDEDJDJDKDKDMDMDZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGEGEGFGFGGGGGHGHGIGIGMGMGNGNGQGQGRGRGWGWHKHKHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIOIQIQISISITITJEJEJMJMJOJOJPJPKEKEKGKGKHKHKIKIKMKMKRKRKWKWKZKZLALALBLBLILI