Enchanted Easter (CjS H-30) Etched Nail Art Stamping Plate-20% off
Clear Jelly Stamper

Enchanted Easter (CjS H-30) Etched Nail Art Stamping Plate

$11.96$14.95Save $2.99
In StockCACA
Title (1 variants)

Default Title

SKU: 2030H

$11.96

In stock

View Now

Description

Clear Jelly Stamper layered stamping plates are the best on the market. We don't just send you a stamping plate...

Here's what you get with this plate!

  • 14.5cm x 9.5cm Premium quality layered stamping plate PACKED FULL of custom curated designs
  • Inspiration Colored Spec Sheet
  • Premium Backing 

Enchanted Easter by Clear jelly Stamper

The H-30 Enchanted Easter steel layered nail art stamping plate by Clear Jelly Stamper captures the whimsical essence of Easter with a charming Scandinavian feel. This intricately designed plate features a delightful array of Easter-themed motifs including adorable bunnies, intricately decorated Easter eggs, cheerful chickens, blooming flowers, delicate leaves, winding vines, and heartwarming hearts.

Adding to its appeal, the plate also includes a cutie angel motif, adding a touch of innocence and magic to your nail art creations. Accompanying these charming images are carefully crafted texts such as "egg hunt," "hoppy Easter," "hunting season," and "happy Easter," enhancing the Easter spirit and providing endless creative possibilities for your nail designs.


Product Information

BrandClear Jelly Stamper
CategoryLarge (14x9)
MPN / SKU2030H
Item Group2185287499874
CurrencyUSD
CountryCA

Ships to (130 countries)

AEAEAGAGAIAIAOAOARARATATAUAUAWAWBEBEBGBGBMBMBNBNBOBOBRBRBSBSBWBWBYBYBZBZCACACHCHCICICLCLCNCNCOCOCRCRCVCVCWCWCYCYCZCZDEDEDKDKDMDMDODOECECEEEEEGEGERERESESETETFIFIFJFJFRFRGBGBGDGDGFGFGHGHGIGIGPGPGQGQGRGRGTGTGYGYHKHKHNHNHRHRHTHTHUHUIDIDIEIEILILIMIMININIQIQISISITITJEJEJMJMJOJOJPJPKEKEKGKGKRKRKZKZLBLBLKLKLRLRLTLTLVLVMQMQMSMSMTMTMUMUMWMWMXMXMYMYMZMZNANANCNCNGNGNININLNLNONONZNZOMOMPAPAPEPEPHPHPKPKPLPLPTPT
Enchanted Easter (CjS H-30) Etched Nail Art Stamping Plate — Bobby