Shea Moisture Jamaican Black Castor Oil Strengthen & Restore Leave-in ConditionerOut of stock-22% off
Shea Moisture

Shea Moisture Jamaican Black Castor Oil Strengthen & Restore Leave-in Conditioner

BHD 8.40BHD 10.80Save BHD 2.40
Out of StockBHBH
Size (1 variants)

12oz

SKU: 764302215844

BHD 8.40

Out of stock

View Now

Description

Full Product Description This reparative leave-in conditioner softens and detangles hair while controlling frizz. Perfect for those who regularly color, straighten, perm or heat style their hair, as well as kinky, curly or wavy natural styles. Formulated with Jamaican Black Castor Oil and certified organic Shea Butter to nourish, moisturize and support elasticity so hair resists breakage when detangling. Conditioners provide a protective layer that improves the appearance of split ends. Peppermint stimulates the scalp for an invigorating experience. Product Details SheaMoisture is dedicated to maintaining the accuracy of the ingredient lists on this website. However, because raw ingredients listings are subject to change due to INCI, we cannot guarantee that these lists are complete, up-to-date and/or error-free. For an accurate listing of ingredients in each product, please refer to your product packaging. Usage Instructions Apply to clean, towel dried hair. Work a generous amount of product into hair from root to ends. Gently comb through for even distribution. Do not rinse. Apply additional product as needed depending on hair length and condition. Ingredients Water, Ricinus Communis (Castor) Seed Oil, Stearyl Alcohol, Cetyl Alcohol, Behentrimonium Chloride, Butyrospermum Parkii (Shea) Butter*‰»«, Cocos Nucifera (Coconut) Oil, Dicaprylyl Ether, Panthenol, Hydrolyzed Rice Protein, Simmondsia Chinensis (Jojoba) Seed Oil, Hydrolyzed Keratin, Hydroxyethylcellulose, Adansonia Digitata (Baobab) Seed Oil, Glycerin (Vegetable), Aloe Barbadensis Leaf Juice, Macadamia Ternifolia Seed Oil, Mauritia Flexuosa Fruit (Buriti) Oil, Vinegar, Mentha Piperita (Peppermint) Leaf Extract, Trifolium Pratense (Clover) Flower Extract, Niacin, Tocopheryl Acetate, Hydrolyzed Vegetable Protein PG-Propyl Silanetriol, Yeast Extract, Caprylyl Glycol, Caprylhydroxamic Acid, Fragrance (Essential Oil Blend) *Certified Organic Ingredient ‰»«Fair Trade Ingredient

Product Information

BrandShea Moisture
CategoryLeave in
MPN / SKU764302215844
Item Group6102917841054
CurrencyBHD
CountryBH

Ships to (199 countries)

ACACADADAEAEALALAMAMAOAOARARATATAUAUAXAXAZAZBABABDBDBEBEBFBFBGBGBHBHBIBIBJBJBNBNBOBOBRBRBSBSBTBTBWBWBYBYCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCXCXCYCYCZCZDEDEDJDJDKDKDMDMDZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGEGEGFGFGGGGGHGHGIGIGMGMGNGNGQGQGRGRGWGWHKHKHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIOIQIQISISITITJEJEJMJMJOJOJPJPKEKEKGKGKHKHKIKIKMKMKRKRKWKWKZKZLALALBLBLILI