SKALA Expert - Creme mais Cachinhos 1Kg - Curls Kids 2 in 1 Cream Net 35.27Oz
Skala

SKALA Expert - Creme mais Cachinhos 1Kg - Curls Kids 2 in 1 Cream Net 35.27Oz

BHD 7.80
In StockBHBH
Title (1 variants)

Default Title

SKU: 7897042017812

BHD 7.80

In stock

View Now

Description

The Skala Expert #MaisCachinhos Kids line came to bring a lot of hydration to children withcurly hair! We combine assets that provide softness and shine in a delicate formulation, developed to take care of the wires gently. In addition, the entire line is released, that is, without sulfates, parabens, petrolatum and mineral oil. and the best of all is yet to come: it can be used as a Treatment Cream and Styling Cream. Just pass and leave all day. the products eliminate frizz, moisturize and give life to dull hair. the #MaisCachinhos line is indicated for children over 3 years old who want volume in the right measure and defined strands, without leaving residue. All the best for a joyful routine!

Product Information

BrandSkala
CategoryConditioner
MPN / SKU7897042017812
Item Group8414997741726
CurrencyBHD
CountryBH

Ships to (199 countries)

ACACADADAEAEALALAMAMAOAOARARATATAUAUAXAXAZAZBABABDBDBEBEBFBFBGBGBHBHBIBIBJBJBNBNBOBOBRBRBSBSBTBTBWBWBYBYCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCXCXCYCYCZCZDEDEDJDJDKDKDMDMDZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGEGEGFGFGGGGGHGHGIGIGMGMGNGNGQGQGRGRGWGWHKHKHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIOIQIQISISITITJEJEJMJMJOJOJPJPKEKEKGKGKHKHKIKIKMKMKRKRKWKWKZKZLALALBLBLILI
SKALA Expert - Creme mais Cachinhos 1Kg - Curls Kids 2 in 1 Cream Net 35.27Oz — Bobby