Shea Moisture Raw Shea Butter Moisture Retention Conditioner 13oz-25% off
Shea Moisture

Shea Moisture Raw Shea Butter Moisture Retention Conditioner 13oz

BHD 7.20BHD 9.60Save BHD 2.40
In StockBHBH
Title (1 variants)

Default Title

SKU: 764302280217

BHD 7.20

In stock

View Now

Description

Full Product Description Raw Shea Butter Moisture Restorative Conditioner - SheaMoisture Conditioners Trying to figure out what to do with hair that is dry and damaged? This SheaMoisture Raw Shea Butter Moisture Restorative Conditioner offers the perfect solution. Our leave-in or rinse out conditioner gives hair the kind of hydrating moisture it craves, all in one treatment. And this SheaMoisture conditioner helps restore dull, lifeless hair to its healthier, shinier version. For easier detangling after shampooing, apply and rinse out. For a restorative treatment, apply and leave in all day or for a desired length of time. Perfect for transitioning to natural styles. Product Details SheaMoisture is dedicated to maintaining the accuracy of the ingredient lists on this website. However, because raw ingredients listings are subject to change due to INCI, we cannot guarantee that these lists are complete, up-to-date and/or error-free. For an accurate listing of ingredients in each product, please refer to your product packaging. Usage Instructions After shampooing with RAW SHEA BUTTER MOISTURE RETENTION SHAMPOO, work conditioner through hair from roots to ends. Leave on for 3 minutes, then rinse thoroughly. For deeper conditioning, leave on for up to 15 minutes. As a leave-in, work a dime-sized amount through damp hair, then style as desired Ingredients Water, Stearyl Alcohol, Olea Europaea (Olive) Fruit Oil, Behentrimonium Chloride, Cetyl Alcohol, Butyrospermum Parkii (Shea) Butter*‰»«, Glyceryl Caprylate, Argania Spinosa Kernel Oil, Macrocystis Pyrifera (Kelp) Extract, Simmondsia Chinensis (Jojoba) Seed Oil, Daucus Carota Sativa (Carrot) Seed Oil, Hydrolyzed Silk, Hydrolyzed Soy Protein, Aloe Barbadensis Leaf Juice, Panthenol, Tocopheryl Acetate, Dicaprylyl Ether, Sodium lsostearoyl Lactylate, Sodium Benzoate, Hydroxyethylcellulose, Glyceryl Undecylenate, Fragrance (Essential Oil Blend)

Product Information

BrandShea Moisture
CategoryConditioner
MPN / SKU764302280217
Item Group6102917152926
CurrencyBHD
CountryBH

Ships to (199 countries)

ACACADADAEAEALALAMAMAOAOARARATATAUAUAXAXAZAZBABABDBDBEBEBFBFBGBGBHBHBIBIBJBJBNBNBOBOBRBRBSBSBTBTBWBWBYBYCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCXCXCYCYCZCZDEDEDJDJDKDKDMDMDZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGEGEGFGFGGGGGHGHGIGIGMGMGNGNGQGQGRGRGWGWHKHKHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIOIQIQISISITITJEJEJMJMJOJOJPJPKEKEKGKGKHKHKIKIKMKMKRKRKWKWKZKZLALALBLBLILI