Golden Pearl Beauty Cream For Acne Wrinkles Dark Spot Yellow
Golden Pearl

Golden Pearl Beauty Cream For Acne Wrinkles Dark Spot Yellow

BHD 3.60
In StockBHBH
Title (1 variants)

Default Title

SKU: 8964001078029

BHD 3.60

In stock

View Now

Description

Golden Pearl Beauty Cream is your ultimate solution for acne, wrinkles, and dark spots. This specialized beauty cream is designed to effectively target and address these common skin concerns, helping you achieve a clearer, smoother, and more youthful complexion. Unlock the secret to flawless skin with Golden Pearl Beauty Cream and confidently embrace a radiant appearance. Acne Treatment: Golden Pearl Beauty Cream is formulated with powerful ingredients that combat acne and help prevent future breakouts. It works by reducing excess oil production, unclogging pores, and soothing inflammation, resulting in a clearer and healthier-looking skin. Wrinkle Reduction: This beauty cream is enriched with anti-aging ingredients that help minimize the appearance of fine lines and wrinkles. It improves skin elasticity, promoting a smoother and more youthful complexion. Dark Spot Corrector: Say goodbye to pesky dark spots and hyperpigmentation with Golden Pearl Beauty Cream. It contains potent ingredients that fade dark spots, even out skin tone, and reveal a more luminous and radiant skin. Nourishing and Moisturizing: Infused with skin-nourishing ingredients, this beauty cream provides deep hydration and moisturization. It replenishes essential nutrients, improving skin texture and leaving it soft, supple, and well-hydrated. Lightweight and Non-Greasy: Golden Pearl Beauty Cream has a lightweight texture that quickly absorbs into the skin, without leaving a greasy or sticky residue. It allows for comfortable all-day wear, making it suitable for use under makeup. Trusted Brand: Golden Pearl is a trusted brand known for its quality skincare products. With a commitment to excellence, Golden Pearl Beauty Cream is formulated to meet the highest standards of effectiveness and customer satisfaction. Say goodbye to acne, wrinkles, and dark spots with Golden Pearl Beauty Cream. Experience the power of targeted skincare and reveal a more flawless and youthful complexion. Embrace the nourish

Product Information

BrandGolden Pearl
CategoryCream
MPN / SKU8964001078029
Item Group8618641359006
CurrencyBHD
CountryBH

Ships to (199 countries)

ACACADADAEAEALALAMAMAOAOARARATATAUAUAXAXAZAZBABABDBDBEBEBFBFBGBGBHBHBIBIBJBJBNBNBOBOBRBRBSBSBTBTBWBWBYBYCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCXCXCYCYCZCZDEDEDJDJDKDKDMDMDZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGEGEGFGFGGGGGHGHGIGIGMGMGNGNGQGQGRGRGWGWHKHKHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIOIQIQISISITITJEJEJMJMJOJOJPJPKEKEKGKGKHKHKIKIKMKMKRKRKWKWKZKZLALALBLBLILI