Colombia Las Margarita "Hami Melon" CO2 A. HoneyOut of stock
The Crackpots Coffee Roaster

Colombia Las Margarita "Hami Melon" CO2 A. Honey

RM81.00
Out of StockMYMY
Size (2 variants)

200g

RM81.00

Out of stock

1kg

RM319.00

Out of stock

View Now

Description

Tasting Note:  Hami Melon | Watermelon | Sweet 

Varietal Processing Method  Altitude
Castillo Supercritical CO2 A. Honey 1700-1800m

 Size:  200g/1kg

Brewing Recommendation: Filter Brews / Modern Espresso 

Forget artificial syrups and surface coatings; this is flavor infusion the next-level way—a geeky, brilliant process that lets us lock in phenomenal, pure taste.

Supercritical CO2

This method essentially uses a pressurized fluid to drive flavor deep inside the coffee bean. The process starts by taking CO2 and controlling its heat and pressure to create a Supercritical Fluid CO2. In this unique state, the CO2 can dissolve flavor like a liquid but penetrate matter like a gas.

A clean, natural flavor extract is dissolved into this CO2 carrier. When this solution is introduced to the coffee beans, the fluid quickly diffuses into all the microscopic pores, ensuring the flavor reaches the core of the bean, rather than just staying on the surface.

The final, essential step involves rapidly dropping the pressure. The CO2 instantly turns back into a gas and harmlessly escapes, leaving zero residue. The flavor molecules, having nowhere to go, are then perfectly deposited and locked within the bean's structure, resulting in a consistent and deeply infused product.

Product Information

BrandThe Crackpots Coffee Roaster
CategorySingle Origin
Item Group8617529704626
CurrencyMYR
CountryMY

Ships to (202 countries)

ADADAEAEAFAFAGAGAIAIALALAMAMAOAOARARATATAUAUAWAWAZAZBABABBBBBDBDBEBEBFBFBGBGBHBHBIBIBJBJBLBLBMBMBOBOBRBRBSBSBTBTBWBWBYBYBZBZCACACFCFCHCHCKCKCLCLCMCMCNCNCOCOCRCRCVCVCWCWCYCYCZCZDEDEDJDJDKDKDMDMDODODZDZECECEEEEEGEGERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGDGDGEGEGFGFGGGGGHGHGIGIGLGLGMGMGPGPGRGRGTGTGYGYHKHKHNHNHRHRHTHTHUHUIEIEILILININIQIQISISITITJEJEJMJMJOJOJPJPKEKEKGKGKHKHKIKIKMKMKNKNKRKRKWKWKYKYKZKZ
Colombia Las Margarita "Hami Melon" CO2 A. Honey — Bobby