Shea Moisture Moringa & Avocado Power Greens ShampooOut of stock
Shea Moisture

Shea Moisture Moringa & Avocado Power Greens Shampoo

BHD 9.60
Out of StockBHBH
Size (1 variants)

13oz

SKU: 764302015079

BHD 9.60

Out of stock

View Now

Description

Full Product Description Gently cleanses hair without stripping strands of natural oils. Designed to give hair a gentle lather while maintaining moisture; leaving strands feeling nourished and shiny, improving the overall appearance of the hair. Product Details SheaMoisture is dedicated to maintaining the accuracy of the ingredient lists on this website. However, because raw ingredients listings are subject to change due to INCI, we cannot guarantee that these lists are complete, up-to-date and/or error-free. For an accurate listing of ingredients in each product, please refer to your product packaging. Usage Instructions Apply to wet hair and gently massage into a rich lather. Rinse thoroughly. Repeat if necessary. Ingredients Water, Sodium Lauroyl Methyl Isethionate, Cocamidopropyl Betaine, Glycol Distearate, Glycerin (Vegetable), Persea Gratissima (Avocado) Oil, Sodium Cocoyl Isethionate, Caprylic/Capric Triglyceride, Guar Hydroxypropyltrimonium Chloride, Moringa Oleifera Seed Oil, Panthenol, Butyrospermum Parkii (Shea) Butter*?, Brassica Oleracea Acephala (Kale) Leaf Extract, Sodium Methyl Cocoyl Taurate, Hydrolyzed Rice Protein, Hydrolyzed Soy Protein, Coconut Acid, Aloe Barbadensis Flower Extract, Camellia Sinensis (Green Tea) Leaf Powder, Sodium Isethionate, Melia Azadirachta (Neem) Leaf Extract, Melia Azadirachta (Neem) Flower Extract, Corallina Officinalis Extract, Sodium Methyltaurate, Coccinia Indica Fruit Extract, Solanum Melongena (Eggplant) Fruit Extract, Chlorella Vulgaris Extract, Citrus Medica Limonum (Lemon) Juice, Curcuma Longa (Turmeric) Root Extract, Ocimum Sanctum (Basil) Leaf Extract, Ocimum Basilicum (Basil) Flower/Leaf Extract, Benzyl Alcohol, Trisodium Ethylenediamine Disuccinate, Sodium Chloride, Triethyl Citrate, Caprylyl Glycol, Sodium Benzoate, Benzoic Acid, Fragrance (Essential Oil Blend) *Certified Organic Ingredient ?Fair Trade Ingredient

Product Information

BrandShea Moisture
CategoryShampoo
MPN / SKU764302015079
Item Group6615861526686
CurrencyBHD
CountryBH

Ships to (199 countries)

ACACADADAEAEALALAMAMAOAOARARATATAUAUAXAXAZAZBABABDBDBEBEBFBFBGBGBHBHBIBIBJBJBNBNBOBOBRBRBSBSBTBTBWBWBYBYCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCXCXCYCYCZCZDEDEDJDJDKDKDMDMDZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGEGEGFGFGGGGGHGHGIGIGMGMGNGNGQGQGRGRGWGWHKHKHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIOIQIQISISITITJEJEJMJMJOJOJPJPKEKEKGKGKHKHKIKIKMKMKRKRKWKWKZKZLALALBLBLILI
Shea Moisture Moringa & Avocado Power Greens Shampoo — Bobby