Cantu Color Protecting ShampooOut of stock
Cantu

Cantu Color Protecting Shampoo

BHD 7.80
Out of StockBHBH
Size (1 variants)

13oz

SKU: 817513016820

BHD 7.80

Out of stock

View Now

Description

Color Protecting Shampoo Cantu Color Protecting Shampoo cleanses hair and scalp without stripping color. Keeps your red, blond, brown, or black hues vibrant longer! Limit fade with our unique sulfate-free formula specially made with Quinoa Protein Color Protecting Technology designed to lock in color and limit fade due to rinse-off. No mineral oil, sulfates, parabens, silicones, phthalates, gluten, paraffin or propylene. Benefits: Washes away build-up without stripping color Reduces color fade while improving shine For color treated hair Formulated with Quinoa ProTech™ Technology: up to 84% less red color fade when Cantu Color Protecting Shampoo and Conditioner are used as a system HOW TO USE Lather into damp hair beginning at the root and work toward ends. Rinse and repeat as needed.

Product Information

BrandCantu
CategoryShampoo
MPN / SKU817513016820
Item Group6059679219870
CurrencyBHD
CountryBH

Ships to (199 countries)

ACACADADAEAEALALAMAMAOAOARARATATAUAUAXAXAZAZBABABDBDBEBEBFBFBGBGBHBHBIBIBJBJBNBNBOBOBRBRBSBSBTBTBWBWBYBYCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCXCXCYCYCZCZDEDEDJDJDKDKDMDMDZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGEGEGFGFGGGGGHGHGIGIGMGMGNGNGQGQGRGRGWGWHKHKHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIOIQIQISISITITJEJEJMJMJOJOJPJPKEKEKGKGKHKHKIKIKMKMKRKRKWKWKZKZLALALBLBLILI