Creme Of Nature Intensive Conditioner Treatment 12Oz
Crème of Nature

Creme Of Nature Intensive Conditioner Treatment 12Oz

BHD 6.00
In StockBHBH
Size (1 variants)

12oz

SKU: 075724252028

BHD 6.00

In stock

View Now

Description

Creme of Nature with Argan Oil Intensive Conditioning Treatment is an intensively deep conditioning treatment that strengthens, revitalizes and gives hair Exotic Shine.™ It prevents hair breakage and deeply infuses moisture from the inside out. Ideal for all hair types, including relaxed, natural and color-treated hair, this treatment can be used after every shampoo as a quick conditioner, or every week as a reconstructor. Infused with Argan Oil from Morocco for exotic shine, nourishment and protection Strengthens and prevents hair breakage Deeply infuses moisture Directions: After shampooing with Creme of Nature Shampoo, apply a generous amount to hair and comb through for even distribution. Place a plastic cap over the hair and sit under a warm hooded dryer for 10-15 minutes. Rinse thoroughly and follow with any Creme of Nature with Argan Oil styling product. Ingredients: Aqua (Water) (Eau), Glycerin, Cetearyl Alcohol, Cetyl Alcohol, Dicetyldimonium Chloride, Polyquaternium-37, Lanolin Oil, PEG-12 Dimethicone, Propylene Glycol Dicaprylate/Dicaprate, Behentrimonium Methosulfate, Polyquaternium-10, Amodimethicone, Phenyl Trimethicone, Isopropyl Alcohol, Dimethiconol, Isostearyl Ethylimidazolinium Ethosulfate, PPG-1 Trideceth-6, Panthenol, Propylene Glycol, Argania Spinosa Kernel Oil, Hydrolyzed Wheat Protein, Olea Europaea (Olive) Fruit Oil, Mel (Honey) (Miel), Cocodimonium Hydroxypropyl Hydrolyzed Wheat Protein, Aloe Barbadensis Leaf Juice, Parfum (Fragrance), Phenoxyethanol, Methylisothiazolinone Size: 12 fl oz / 354 ml

Product Information

BrandCrème of Nature
CategoryConditioner
MPN / SKU075724252028
Item Group6783823413406
CurrencyBHD
CountryBH

Ships to (199 countries)

ACACADADAEAEALALAMAMAOAOARARATATAUAUAXAXAZAZBABABDBDBEBEBFBFBGBGBHBHBIBIBJBJBNBNBOBOBRBRBSBSBTBTBWBWBYBYCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCXCXCYCYCZCZDEDEDJDJDKDKDMDMDZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGEGEGFGFGGGGGHGHGIGIGMGMGNGNGQGQGRGRGWGWHKHKHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIOIQIQISISITITJEJEJMJMJOJOJPJPKEKEKGKGKHKHKIKIKMKMKRKRKWKWKZKZLALALBLBLILI
Creme Of Nature Intensive Conditioner Treatment 12Oz — Bobby