Shea Moisture Manuka Honey & Yogurt Hydrate + Repair Multi-Action Leave-In 13oz-29% off
Shea Moisture

Shea Moisture Manuka Honey & Yogurt Hydrate + Repair Multi-Action Leave-In 13oz

BHD 7.20BHD 10.20Save BHD 3.00
In StockBHBH
Title (1 variants)

Default Title

SKU: 764302231448

BHD 7.20

In stock

View Now

Description

Full Product Description Shea Leave-In Conditioner Spray - Manuka Honey & Yogurt Hydrate + Repair Multi-Action Leave-In for Hair Your search for the best natural hair product for split ends is over. SheaMoisture's Manuka Honey & Yogurt Hydrate + Repair Multi-Action Leave-In with Mafura & Baobab Oils does it all! This multi-action honey leave-in conditioner blended with Yogurt is everything you've ever wanted in a hair repair treatment. It absorbs quickly to hydrate, recondition and smooth abused hair, and the spray nozzle allows you to spritz just the right amount you need for styling control. This Shea leave-in conditioner spray helps to prepare your locks for easy styling and it protects brittle hair from heat tool and other styling damage. We've blended the right mix of certified organic Shea Butter, reparative Manuka Honey and Yogurt together in a lightweight treatment that fortifies hair with strand supporting proteins in a natural protective layer. You'll also love the way it fights frizz, especially on the hot and humid days, and you may be ecstatic about how it improves the appearance of split ends. Ideal for hair that is prone to breaking, snapping or splitting. Product Details SheaMoisture is dedicated to maintaining the accuracy of the ingredient lists on this website. However, because raw ingredients listings are subject to change due to INCI, we cannot guarantee that these lists are complete, up-to-date and/or error-free. For an accurate listing of ingredients in each product, please refer to your product packaging. Usage Instructions Generously spray product all over clean, damp hair and comb through. Do not rinse. Blow or air-dry. Style as usual. Ingredients Water, Cetrimonium Chloride, Caprylic/Capric Triglyceride, Glycerin (Vegetable), Butyrospermum Parkii (Shea) Butter*, Honey, Yogurt Powder, Yogurt Extract, lnulin, Adansonia Digitata (Baobab) Seed Oil, Trichilia Emetica (Mafura) Seed Oil, Hydrolyzed Wheat Protein PG-Propyl Silanetriol, Bisabolol,

Product Information

BrandShea Moisture
CategoryLeave in
MPN / SKU764302231448
Item Group6615861657758
CurrencyBHD
CountryBH

Ships to (199 countries)

ACACADADAEAEALALAMAMAOAOARARATATAUAUAXAXAZAZBABABDBDBEBEBFBFBGBGBHBHBIBIBJBJBNBNBOBOBRBRBSBSBTBTBWBWBYBYCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCXCXCYCYCZCZDEDEDJDJDKDKDMDMDZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGEGEGFGFGGGGGHGHGIGIGMGMGNGNGQGQGRGRGWGWHKHKHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIOIQIQISISITITJEJEJMJMJOJOJPJPKEKEKGKGKHKHKIKIKMKMKRKRKWKWKZKZLALALBLBLILI