Nittoh Royal Milk Tea Brown SugarOut of stock
Mitsui Norin Co. Ltd.

Nittoh Royal Milk Tea Brown Sugar

$4.19
Out of StockUSUS
Title (1 variants)

Default Title

SKU: 4902831512089

$4.19

In stock

View Now

Description

Nittoh Royal Milk Tea Brown Sugar is a package containing 8 individually wrapped single serving Instant Royal Milk Tea Brown Sugar stick type containers. Indulge in the comforting richness of Nittoh Royal Milk Tea Brown Sugar, a blend crafted especially for true tea lovers. Each stick contains a perfectly measured serving of instant royal milk tea, enhanced with the warm sweetness of Okinawan brown sugar and the creamy depth of Hokkaido whole milk powder. With every sip, you’ll experience the gentle fragrance of brown sugar balanced by the smooth, mellow taste of milk tea—just like the popular flavors served at modern tea stands and cafés. Conveniently packaged in 8 individual sticks, this milk tea is easy to prepare and always fresh. Simply add hot water for a café-quality experience at home, at the office, or wherever you need a moment of comfort. Enjoy a touch of sweetness and relaxation, anytime, anywhere. Instructions: ( How to Brew). Just by putting one stick in a cup and pouring hot water, you can easily enjoy an authentic Nittoh Royal Milk Tea Brown Sugar anytime. Hot : Pour one stick in a cup of hot water (120ml), stir well and enjoy. Iced : Pour 1 stick into Cold Water (120ml). Add several pieces of ice and stir well until it becomes cold. (For a Creamy Cafe Latte use Milk or Soy Milk instead of Water). Nutrition: Energy: 56kcal per one serving (13.5 grams), Protein : 0.6g, Lipid: 0.7g, Carbohydrate: 11.9g, Salt equivalent: 0.03g, Caffeine: 0.01g. Ingredients: Sugar preparation (sugar, dextrin) (made in Korea), skim milk powder preparation (skim milk powder, sugar, dextrin), creaming powder (dextrin, vegetable oil, skim milk powder, milk protein), whole milk powder, black tea extract powder, brown sugar powder Additives: Flavoring, pH adjuster, seasoning (inorganic salt), emulsifier. Manufacturer: Mitsui Norin Co., Ltd., 1-2-9 Nishi-Shimbashi, Minato-ku, Tokyo, Japan. Size: Height: 20 cm. Width: 10 cm. Depth: 5 cm. Weight: 108 grams (8 Sticks x 13.5 grams)

Product Information

BrandMitsui Norin Co. Ltd.
CategoryInstant Tea
MPN / SKU4902831512089
Item Group7752534786096
CurrencyUSD
CountryUS

Ships to (235 countries)

ACACADADAEAEAFAFAGAGAIAIALALAMAMAOAOARARATATAUAUAWAWAXAXAZAZBABABBBBBDBDBEBEBFBFBGBGBHBHBIBIBJBJBLBLBMBMBNBNBOBOBQBQBRBRBSBSBTBTBWBWBYBYBZBZCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCWCWCXCXCYCYCZCZDEDEDJDJDKDKDMDMDODODZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGDGDGEGEGFGFGGGGGHGHGIGIGLGLGMGMGNGNGPGPGQGQGRGRGSGSGTGTGWGWGYGYHKHKHNHNHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIO
Nittoh Royal Milk Tea Brown Sugar — Bobby