Flora & Curls STYLE ME Sweet Hibiscus Curl Defining GelOut of stock-50% off
Flora & Curls

Flora & Curls STYLE ME Sweet Hibiscus Curl Defining Gel

BHD 16.80BHD 33.60Save BHD 16.80
Out of StockBHBH
Size (1 variants)

1000ml

SKU: 5060627510493

BHD 16.80

Out of stock

View Now

Description

A curl defining gel that interacts with each individual hair strand to add body, control and shine. Formulated with our deeply nourishing blend of pure botanicals. Panthenol and rice protein provide extra conditioning, while pure marshmallow root delivers unprecedented slip, and Sweet Almond adds shine, leaving curls healthier, defined and more enhanced. It is perfect for your wash & go's, twist-outs, up-do’s, ponytails, roller sets and more. Our alcohol-free, botanical curl formula encourages instant curl formation, reduces frizz, adds instant slip and softness for your ideal style! Directions Distribute evenly on wet or damp hair. Allow hair to dry. A hooded dryer, or a diffuser may also be used for faster drying. Can be used alone or with the Sweet Hibiscus Curl Activating Lotion for extra moisture and curl support. Ingredients Aqua (Distilled Water), (Vegetable) Glycerine, Citrus Peel Pectin, Xanthan Gum, Althaea Officinalis (Marshmallow Root) Extract, Prunus Amygdalus Dulcis (Sweet Almond) Oil, Vitus Vinifera (Grapeseed) Oil, Hibiscus Sabdariffa (Hibiscus) Flower Extract, Hydrolyzed Rice Protein, Polysorbate 20, Nelumbo Nucifera (Lotus) Flower Extract, Arctium Lappa (Burdock) Root Extract, Citric Acid, Rosmarinus Officinalis (Rosemary) Leaf Extract, Calendula Officinalis (Calendula) Extract, Benzyl Alcohol, Panthenol (Pro-Vitamin B5), Potassium Sorbate, Sodium Benzoate, Citronellol*, Geraniol*, Limonene*, Linalool*, *Citral, Natural Aroma** **100% natural essential oils *Natural component of essential oils No artificial fragrances, colours, silicones, sulfates, parabens and mineral oil. Cruelty free and Vegan. Made for all curl types.

Product Information

BrandFlora & Curls
CategoryStyling Gel
MPN / SKU5060627510493
Item Group7092451836062
CurrencyBHD
CountryBH

Ships to (199 countries)

ACACADADAEAEALALAMAMAOAOARARATATAUAUAXAXAZAZBABABDBDBEBEBFBFBGBGBHBHBIBIBJBJBNBNBOBOBRBRBSBSBTBTBWBWBYBYCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCXCXCYCYCZCZDEDEDJDJDKDKDMDMDZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGEGEGFGFGGGGGHGHGIGIGMGMGNGNGQGQGRGRGWGWHKHKHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIOIQIQISISITITJEJEJMJMJOJOJPJPKEKEKGKGKHKHKIKIKMKMKRKRKWKWKZKZLALALBLBLILI
Flora & Curls STYLE ME Sweet Hibiscus Curl Defining Gel — Bobby