Black Footless Toe Loop Floral Thigh Highs
COAXcopenhagen.com

Black Footless Toe Loop Floral Thigh Highs

€16.00
In StockDKDK
Size (1 variants)

One Size

SKU: 6221

€16.00

In stock

View Now

Description

Black Footless Toe Loop Floral Thigh Highs Where elegance meets edge. These footless floral fishnet thigh highs wrap your legs in a delicate lace motif with just the right dose of daring. The toe loop detail adds a sleek, modern twist, while the high-thigh cut sculpts and flatters. Designed for impact - from heel to hip. Soft, stretchy, and utterly seductive, they blur the line between romantic and risqué. A statement from heel to toe With their unique floral pattern and footless design, these thigh highs blend femininity with fetish. The toe loops ensure everything stays in place while keeping your look dangerously on point. For styling that turns heads - think COAX Copenhagen. Whether styled with heels or nothing at all, they promise to leave a lasting impression... at least until they come off. DETAILS & FEATURES Footless fishnet thigh highs with toe loops Romantic floral lace motif Elasticized high-thigh band Soft, high-stretch fit Wear with heels or barefoot

Product Information

BrandCOAXcopenhagen.com
CategoryBrand:Leg Avenue
MPN / SKU6221
Item Group14963021447494
CurrencyEUR
CountryDK

Ships to (235 countries)

ADADAEAEAFAFAGAGAIAIALALAMAMAOAOARARATATAUAUAWAWAXAXAZAZBABABBBBBDBDBEBEBFBFBGBGBHBHBIBIBJBJBLBLBMBMBNBNBOBOBQBQBRBRBSBSBTBTBWBWBYBYBZBZCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCWCWCXCXCYCYCZCZDEDEDJDJDKDKDMDMDODODZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGDGDGEGEGFGFGGGGGHGHGIGIGLGLGMGMGNGNGPGPGQGQGRGRGSGSGTGTGWGWGYGYHKHKHNHNHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIOIQIQ
Black Footless Toe Loop Floral Thigh Highs — Bobby