Dark Angel (CjSH-59) Etched Nail Art Stamping Plate
Clear Jelly Stamper

Dark Angel (CjSH-59) Etched Nail Art Stamping Plate

$14.95
In StockCACA
Title (1 variants)

Default Title

SKU: 2059H

$14.95

In stock

View Now

Description

Clear Jelly Stamper layered stamping plates are the best on the market. We don't just send you a stamping plate...

Here's what you get with this plate!

  • 8cm x 8cm Premium quality layered stamping plate PACKED FULL of custom curated designs
  • Inspiration Colored Spec Sheet
  • Premium Backing

Dark Angel by Clear Jelly StamperΒ 

Welcome to the bewitching world of CjSH-59 - "Dark Angel" Steel Nail Art Layered Stamping Plate! Unleash your creativity and let the allure of the dark angel take flight with these mesmerizing designs that boast full coverage and enchanting motifs.

Step into the realm of shadows, where spider webs weave tales of mystery, and bats soar under the spell of the bewitching moon. Embrace the allure of the devil's domain with designs that invoke the power of black magic, spreading its charm with every stroke of your stamp.

Let your nails take flight with the majestic wings of an angel, or embrace the darker side with skull motifs and a mysterious black hat. Allow the angelic presence to bloom with flowers that enchant even the darkest corners of the night.

As you delve deeper into this captivating plate, you'll encounter scary trees and branches that seem to whisper secrets and skeletons that dance with glee under the moonlit sky. Let your manicure come to life with a hauntingly scary face that sends shivers down the spine.

Witches and their wicked ways add an extra dose of enchantment to your nails, capturing the essence of the dark angel's world. Embrace the magic and mystery as you create nail art that will bewitch all who gaze upon it.

With CjSH-59 - "Dark Angel," your nail art transforms into a canvas of shadows and splendor, where the light and dark intertwine in playful harmony. Embrace the allure of the dark angel and let your nails tell a story of captivating charm and darkly magical adventures. Dive into the depths of this plate and unleash your inner sorceress to create nail art that will leave everyone under your spell! πŸ‘ΌπŸ–€πŸŒ™


14 x 9 cm

Product Information

BrandClear Jelly Stamper
CategoryLarge (14x9)
MPN / SKU2059H
Item Group4489614393442
CurrencyUSD
CountryCA

Ships to (130 countries)

AEAEAGAGAIAIAOAOARARATATAUAUAWAWBEBEBGBGBMBMBNBNBOBOBRBRBSBSBWBWBYBYBZBZCACACHCHCICICLCLCNCNCOCOCRCRCVCVCWCWCYCYCZCZDEDEDKDKDMDMDODOECECEEEEEGEGERERESESETETFIFIFJFJFRFRGBGBGDGDGFGFGHGHGIGIGPGPGQGQGRGRGTGTGYGYHKHKHNHNHRHRHTHTHUHUIDIDIEIEILILIMIMININIQIQISISITITJEJEJMJMJOJOJPJPKEKEKGKGKRKRKZKZLBLBLKLKLRLRLTLTLVLVMQMQMSMSMTMTMUMUMWMWMXMXMYMYMZMZNANANCNCNGNGNININLNLNONONZNZOMOMPAPAPEPEPHPHPKPKPLPLPTPT