Disaar Beauty Vitamin C Whitening Moisturizing After Bathing Lotion - 480ml
Disaar

Disaar Beauty Vitamin C Whitening Moisturizing After Bathing Lotion - 480ml

BHD 4.80
In StockBHBH
Title (1 variants)

Default Title

SKU: 6932511218459

BHD 4.80

In stock

View Now

Description

Description: Disaar Vitamin C Lotion to moisturize and lighten the skin after showering, thanks to it containing natural plant protein and pure mineral water that penetrates the skin cells and moisturizes the dry cells and increases their whiteness, freshness and moisture. This lotion from Disaar contains vitamin C, which is on the list of the most beneficial vitamins for skin health and freshness, especially for oily skin, as it works to rebalance the oily secretions in it and gives it radiance and freshness, in addition to lightening its color. Benefits and features: It reduces skin water loss, which allows your skin to retain moisture well. It treats facial paleness and dullness, and gives the skin a wonderful freshness. It evens out skin tone and is a reliable source for treating a wide range of skin infections. Treats hyperpigmentation of the skin including sun spots, age spots, and melasma. It moisturizes dry cells, increases their whiteness, freshness and moisture, and prevents sagging skin. Suitable for all skin types. How to use: Apply to the skin after showering with a simple massage until it penetrates the skin cells. Warnings: For external use only. Store in a cool, dry place, out of reach of children. Stop using the product if itching or allergy occurs.

Product Information

BrandDisaar
CategoryLotion
MPN / SKU6932511218459
Item Group7744864321694
CurrencyBHD
CountryBH

Ships to (199 countries)

ACACADADAEAEALALAMAMAOAOARARATATAUAUAXAXAZAZBABABDBDBEBEBFBFBGBGBHBHBIBIBJBJBNBNBOBOBRBRBSBSBTBTBWBWBYBYCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCXCXCYCYCZCZDEDEDJDJDKDKDMDMDZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGEGEGFGFGGGGGHGHGIGIGMGMGNGNGQGQGRGRGWGWHKHKHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIOIQIQISISITITJEJEJMJMJOJOJPJPKEKEKGKGKHKHKIKIKMKMKRKRKWKWKZKZLALALBLBLILI