Shizuoka Powdered Green Tea (100 grams)Out of stock
Sawaguchi Farm Tea Factory Co. Ltd.

Shizuoka Powdered Green Tea (100 grams)

$4.89
Out of StockUSUS
Title (1 variants)

Default Title

SKU: 4903148102345

$4.89

In stock

View Now

Description

Shizuoka Powdered Green Tea is an instant type green tea powder made so you can conveniently enjoy a delicious fresh cup of tea anytime. Shizuoka Powdered Green Tea lets you enjoy the true taste of Japanese green tea with effortless convenience. Made exclusively from carefully selected tea leaves grown in Shizuoka Prefecture—Japan’s most renowned tea-producing region—this finely milled powder delivers a fresh, authentic cup anytime. Unlike traditional brewed tea, this instant green tea dissolves easily in hot or cold water, eliminating the need for a teapot while preserving the natural flavor and aroma of freshly brewed green tea. Each sip reflects the gentle sweetness, refreshing bitterness, and clean finish characteristic of Shizuoka tea. Because the whole tea leaf is consumed, you benefit fully from its natural nutrients. Rich in catechins, antioxidants, vitamins C and E, and dietary fiber, this powdered green tea supports a healthy, balanced lifestyle. Packaged in a convenient resealable 100-gram bag, one pouch makes up to 200 cups—perfect for daily enjoyment at home, work, or on the go. Additive-free and colorant-free, this 100% Japan-grown green tea offers pure, uncomplicated quality in every cup. Instructions: (How to Brew). No Kyusu (Teapot) needed. Just stir a spoon of Shizuoka Powdered Green Tea into Hot or Cold water for a perfect cup of tea. Hot: Use one small spoon (.5 grams) in one cup (100ml) of hot water. Cold: Use one small spoon (.5 grams) in one cup (10ml) of Cold Water. Stir well and add several cubes. Ingredients: Green Tea (Produced in Shizuoka, Japan). Nutrition: Energy: 229kcal (per 100 grams), Protein: 24.5g, Fat: 4.7g, Carbohydrates: 47.7g, Salt equivalent amount: 0.0g. Manufacturer: Sawaguchi Farm Tea Factory Co., Ltd., 606 Yawata, Fujieda City, Shizuoka Prefecture, Japan. Seller: Uji Wazukaen Co., Ltd., 5-3-11 Nagatanaka, Higashiosaka City, Osaka Prefecture, Japan. Country of Origin: Japan (Shizuoka Prefecture). Size: Height: 21.5 cm. Wid

Product Information

BrandSawaguchi Farm Tea Factory Co. Ltd.
CategoryJapanese Green Tea
MPN / SKU4903148102345
Item Group7873443987504
CurrencyUSD
CountryUS

Ships to (235 countries)

ACACADADAEAEAFAFAGAGAIAIALALAMAMAOAOARARATATAUAUAWAWAXAXAZAZBABABBBBBDBDBEBEBFBFBGBGBHBHBIBIBJBJBLBLBMBMBNBNBOBOBQBQBRBRBSBSBTBTBWBWBYBYBZBZCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCWCWCXCXCYCYCZCZDEDEDJDJDKDKDMDMDODODZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGDGDGEGEGFGFGGGGGHGHGIGIGLGLGMGMGNGNGPGPGQGQGRGRGSGSGTGTGWGWGYGYHKHKHNHNHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIO