Black wild rose lace thigh highs
COAXcopenhagen.com

Black wild rose lace thigh highs

€18.00
In StockDKDK
Size (2 variants)

One Size

SKU: 6216

€18.00

In stock

Plus Size

SKU: 6216X

€18.00

In stock

View Now

Description

Black Wild Rose Lace Thigh Highs For the romantics with a wild side. These floral lace thigh highs feature a moody wild rose motif that clings to your legs like a secret waiting to be revealed. Designed to be worn with your favorite garter belt, they are a seductive upgrade to any lingerie look - or the start of one. The delicate pattern delivers a timeless feel, while the stretch lace moves with your body for comfort that never compromises on sex appeal. Let the lace lead COAX Copenhagen redefines floral with these wild rose thigh highs - made to linger in memory long after the moment has passed. Feminine, powerful, and endlessly tempting. DETAILS & FEATURES Sheer floral lace with wild rose design Designed for use with garter belts Soft stretch fit for comfort and hold 93% nylon / 7% spandex Ideal for layering or standalone seduction

Product Information

BrandCOAXcopenhagen.com
CategoryBrand:Leg Avenue
MPN / SKU6216
Item Group8915346096454
CurrencyEUR
CountryDK

Ships to (235 countries)

ADADAEAEAFAFAGAGAIAIALALAMAMAOAOARARATATAUAUAWAWAXAXAZAZBABABBBBBDBDBEBEBFBFBGBGBHBHBIBIBJBJBLBLBMBMBNBNBOBOBQBQBRBRBSBSBTBTBWBWBYBYBZBZCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCWCWCXCXCYCYCZCZDEDEDJDJDKDKDMDMDODODZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGDGDGEGEGFGFGGGGGHGHGIGIGLGLGMGMGNGNGPGPGQGQGRGRGSGSGTGTGWGWGYGYHKHKHNHNHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIOIQIQ