Shea Moisture Manuka Honey & Yogurt Hydrate & Repair Shampoo 13oz-25% off
Shea Moisture

Shea Moisture Manuka Honey & Yogurt Hydrate & Repair Shampoo 13oz

BHD 7.20BHD 9.60Save BHD 2.40
In StockBHBH
Title (1 variants)

Default Title

SKU: 764302231530

BHD 7.20

In stock

View Now

Description

Full Product Description This SheaMoisture Manuka Honey and Yogurt Shampoo is completely sulfate-free, and it still produces luxurious lather that gently cleanses your follicles while infusing your hair with intensive moisture. Designed to be a protein treatment for damaged hair, our formula contains reconstructive proteins and shine enhancing nutrients. Formulated with certified organic Shea Butter, we build on this strong moisturizing foundation and provide even more hydration and hair follicle healing properties with ultra-moisturizing Manuka Honey. Protein comes from the addition of Yogurt Powder and Yogurt Extract, natural proteins that provide their own richness. For extra ultra-hydration, we include Baobab Oil, Coconut Oil and Mafura Oil, creating an easy and gentle reparative formula to restore moisture and transform coarse hair, improving smoothness, texture and manageability. Regular use leaves hair strands fully restored to their healthy state and looking their best. Product Details SheaMoisture is dedicated to maintaining the accuracy of the ingredient lists on this website. However, because raw ingredients listings are subject to change due to INCI, we cannot guarantee that these lists are complete, up-to-date and/or error-free. For an accurate listing of ingredients in each product, please refer to your product packaging. Usage Instructions Apply to wet hair and gently massage into a rich lather. Rinse thoroughly. Repeat if necessary. For best results, follow with SheaMoisture Hydrate + Recover Conditioner. Ingredients Water, Sodium Lauroyl Methyl lsethionate, Cocoamidopropyl Betaine, Sodium Methyl Cocoyl Taurate, Sodium Cocoyl lsethionate, Glycol Distearate, Glycerin (Vegetable), Butyrospermum Parkii (Shea) Butter*仫, Honey, Yogurt Powder, Yogurt Extract, lnulin, Adansonia Digitata (Baobab) Seed Oil, Trichilia Emetica (Mafura) Seed Oil, Cocos Nucifera (Coconut) Oil, Panthenol, Guar Hydroxypropyltrimonium Chloride, Triethyl Citrate, Caprylyl Glycol, B

Product Information

BrandShea Moisture
CategoryShampoo
MPN / SKU764302231530
Item Group6615861723294
CurrencyBHD
CountryBH

Ships to (199 countries)

ACACADADAEAEALALAMAMAOAOARARATATAUAUAXAXAZAZBABABDBDBEBEBFBFBGBGBHBHBIBIBJBJBNBNBOBOBRBRBSBSBTBTBWBWBYBYCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCXCXCYCYCZCZDEDEDJDJDKDKDMDMDZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGEGEGFGFGGGGGHGHGIGIGMGMGNGNGQGQGRGRGWGWHKHKHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIOIQIQISISITITJEJEJMJMJOJOJPJPKEKEKGKGKHKHKIKIKMKMKRKRKWKWKZKZLALALBLBLILI