As I am Coconut Co Wash ClassicOut of stock
As I am

As I am Coconut Co Wash Classic

BHD 7.80
Out of StockBHBH
Size (1 variants)

16oz

SKU: 858380002141

BHD 7.80

Out of stock

View Now

Description

Cleansing Conditioner Ease of Combing Improves by 55%. Enjoy a Fresh New Start. Remove Product Residue. Preserve Moisture. Did you know that Shampoo removes precious moisture from your hair and scalp? CoWashing (Conditioner Wash) is the best way to cleanse your hair on a regular basis. Our light no-suds conditioning cream gently removes scalp sebum, residue, or product buildup leftover from styling and maintain your curls and coils. This Cowash is different from any other because it contains a special blend of natural ingredients that work to promote healthy hair growth from the follicular level. Benefits Spreads easily throughout hair Gently cleanses hair and scalp Maintains moisture, adds more moisture and helps hair retain moisture until your next cleanse. Makes detangling a breeze Rinses easily from hair. Helps promote a healthy environment for hair growth Gentle enough for daily use. Safe for color-treated hair Ingredients INGREDIENTS: Aqua/Water/Eau, Cetyl Alcohol, Cetrimonium Chloride, Cetearyl Alcohol, Cocos Nucifera (Coconut) Oil, Ricinus Communis (Castor) Seed Oil, Cocos Nucifera (Coconut) Fruit Powder, Citrus Reticulata (Tangerine) Fruit Extract, Phytosterols, Camillia Sinensis Leaf Extract, PEG-40 Castor Oil, Stearlkonium Chloride, Serenoa Serrulata Fruit Extract, Quaternium-18, Propylene Glycol, C12-15 Alkyl Lactate, Fragrance/Parfum, Potassium Sorbate, Caprylyl Glycol, Phenoxyethanol, Abies Balsamea (Balsam Canada) Resin, Potassium Chloride, Limonene. Usage Wet hair thoroughly Rub a liberal amount within palms and distribute throughout hair Work product through hair and massage scalp with fingertips as you would a conventional shampoo Carefully detangle hair with a wide-tooth comb Rinse well Repeat only if necessary to remove excessive product build up or for further scalp cleansing. Follow with conditioning. Use either As I Am¨ Hydration Elation¨ Intensive Conditioning Treatment or As I Am¨ Leave-In Conditioner. Use as needed on an intermittent basis

Product Information

BrandAs I am
CategoryShampoo
MPN / SKU858380002141
Item Group6064364257438
CurrencyBHD
CountryBH

Ships to (199 countries)

ACACADADAEAEALALAMAMAOAOARARATATAUAUAXAXAZAZBABABDBDBEBEBFBFBGBGBHBHBIBIBJBJBNBNBOBOBRBRBSBSBTBTBWBWBYBYCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCXCXCYCYCZCZDEDEDJDJDKDKDMDMDZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGEGEGFGFGGGGGHGHGIGIGMGMGNGNGQGQGRGRGWGWHKHKHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIOIQIQISISITITJEJEJMJMJOJOJPJPKEKEKGKGKHKHKIKIKMKMKRKRKWKWKZKZLALALBLBLILI
As I am Coconut Co Wash Classic — Bobby