Eco Style Professional Styling Gel Black Castor & Flaxseed Oil (32 oz.)
Ecoco

Eco Style Professional Styling Gel Black Castor & Flaxseed Oil (32 oz.)

BHD 9.00
In StockBHBH
Title (1 variants)

Default Title

SKU: 748378004229

BHD 9.00

In stock

View Now

Description

Product Details Eco Style Black Castor & Flaxseed Gel helps to nourish, repair and grown hair. Wheat Protein strengthens and protects hair. Like all of our styling gels it is weightless and will leave your hair with a healthy shine and superior hold. Eco Style Black Castor & Flaxseed Oil Gel is a premium hair styling product that combines a mixture of Vitamin E, Fiber, and Omega-3 for the benefits of promoting hair growth. Moisturizes the roots and scalp, and prevents damage to the hair. Alcohol and silicon free. Provides High Hold and High Shine. Nourishes, repairs, and helps to promote hair growth Long Lasting Hold & Shine No Flake, No Tack Provides shine Usage & Ingredients How to Use: Apply to dry or wet hair. Work desired amount through hair and style. Ingredients: Water/Aqua/Eau, Carbomer, Triethanolamine, Ricinus Communis (Castor) Seed Oil, Linum usitatissimum (Linseed) Seed Oil, Hydrolyzed Wheat Protein, PVP, Glycerin, Phenoxyethanol, Polysorbate 20, Tetrasodum EDTA, Fragrance (Parfum), d-Limonene, LOVE AND PRIDE.

Product Information

BrandEcoco
CategoryStyling Gel
MPN / SKU748378004229
Item Group6736746938526
CurrencyBHD
CountryBH

Ships to (199 countries)

ACACADADAEAEALALAMAMAOAOARARATATAUAUAXAXAZAZBABABDBDBEBEBFBFBGBGBHBHBIBIBJBJBNBNBOBOBRBRBSBSBTBTBWBWBYBYCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCXCXCYCYCZCZDEDEDJDJDKDKDMDMDZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGEGEGFGFGGGGGHGHGIGIGMGMGNGNGQGQGRGRGWGWHKHKHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIOIQIQISISITITJEJEJMJMJOJOJPJPKEKEKGKGKHKHKIKIKMKMKRKRKWKWKZKZLALALBLBLILI
Eco Style Professional Styling Gel Black Castor & Flaxseed Oil (32 oz.) — Bobby