Shea Moisture       African Black Soap Bamboo Charcoal Purification MasqueOut of stock
Shea Moisture

Shea Moisture African Black Soap Bamboo Charcoal Purification Masque

BHD 10.20
Out of StockBHBH
Title (1 variants)

Default Title

SKU: 764302271086

BHD 10.20

Out of stock

View Now

Description

Deeply condition hair and nourish scalp with this intensive treatment masque. African Black Soap, Bamboo Charcoal, Tea Tree Oil, and Willow Bark Extract combine in a potent treatment that boosts hydration levels and nourishes, while absorbing excess oil and removing clogging impurities from the scalp. Hair looks vibrant, lustrous and healthy. Product Details SheaMoisture is dedicated to maintaining the accuracy of the ingredient lists on this website. However, because raw ingredients listings are subject to change due to INCI, we cannot guarantee that these lists are complete, up-to-date and/or error-free. For an accurate listing of ingredients in each product, please refer to your product packaging. Usage Instructions Section clean wet hair. Apply generously. Use a wide tooth comb to distribute evenly from roots to ends. Leave in 5 minutes. Rinse thoroughly. For extra conditioning cover hair with a plastic cap. Apply moderate heat for up to 30 minutes. Rinse thoroughly. When using a hair steamer do not cover hair. Moist heat will add to masqueæ_s hydration. Ingredient Water, Cetearyl Alcohol, Caprylic/Capric Triglyceride, Glycerin (Vegetable),Butyrospermum Parkii (Shea) Butter*‰ª´, Stearyl Alcohol, Cetyl Alcohol, Cocos Nucifera (Coconut) Oil, Persea Gratissima (Avocado) Oil, Aloe Barbadensis Leaf Juice, Behentrimonium Methosulfate, Behentrimonium Chloride, Fragrance (EssentialOil Blend), Panthenol, Hydrogenated Vegetable Oil, Melaleuca Alternifolia (TeaTree) Leaf Oil, Hydroxyethylcellulose, Avena Sativa (Oat) Kernel Flour, Charcoal Powder, Salicylic Acid, Hydrolyzed Vegetable Protein PG-Propyl Silanetriol, Polyquaternium-7, Beta Glucan, Hamamelis Virginiana (Witch Hazel) Extract, lsopropyl Alcohol, Avena Sativa (Oat) Bran Extract, Sodium Palm Kernelate, Sodium Shea Butterate, Sodium Cocoate, Theobroma Cacao (Cocoa) Pod Ash, Salix Nigra (Willow) Bark Extract, Triethyl Citrate, Caprylyl Glycol, Benzoic Acid *Certified Organic Ingredient. ‰ª´Fair Trade Ingredient

Product Information

BrandShea Moisture
CategoryHair Masque
MPN / SKU764302271086
Item Group6701691404446
CurrencyBHD
CountryBH

Ships to (199 countries)

ACACADADAEAEALALAMAMAOAOARARATATAUAUAXAXAZAZBABABDBDBEBEBFBFBGBGBHBHBIBIBJBJBNBNBOBOBRBRBSBSBTBTBWBWBYBYCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCXCXCYCYCZCZDEDEDJDJDKDKDMDMDZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGEGEGFGFGGGGGHGHGIGIGMGMGNGNGQGQGRGRGWGWHKHKHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIOIQIQISISITITJEJEJMJMJOJOJPJPKEKEKGKGKHKHKIKIKMKMKRKRKWKWKZKZLALALBLBLILI