Yoga mat WAVE RIDER BALI - natural rubber, non-slip, eco-friendly fitness, pilates and yoga mat
Moonholi Yoga

Yoga mat WAVE RIDER BALI - natural rubber, non-slip, eco-friendly fitness, pilates and yoga mat

€110.00
In StockPLPL
Title (1 variants)

Default Title

SKU: SKU-153

€110.00

In stock

View Now

Description

Yoga mat Wave Rider Bali - colourful blue gym mat with waves and surfing girl The Wave Rider Bali non-slip yoga and fitness mat is a journey into the depths of the ocean. Feel the compelling force of waves, currents, and wind—an energy that inspires full mindfulness in every asana. On the Wave Rider Bali exercise mat , the ocean comes alive beneath your feet—vibrant shades of blue and swirling waves infuse every movement with energy. The central motif, a lively surfer, transports you straight to Bali’s sunlit beaches, where every gesture reflects strength and freedom in the water’s embrace. A subtle Moonholi logo adds a delicate finishing touch, while the mat itself captivates with both its energy and aesthetic appeal. This natural-rubber workout mat is designed for women who love water, movement, and living in harmony with the world around them. Feel the spirit of a surfer within you—bold, passionate, and full of energy—where every motion on the mat becomes a celebration of life, harmony, and the power of water. It’s a space where body and mind flow together, and yoga becomes an endless journey in the rhythm of the ocean. Stability and comfort — maintain balance like a surfer riding the waves and feel confident in every pose Eco-friendly natural rubber — a sustainable material that cares for the planet and your well-being Ocean energy — let the rhythm of the waves and the sea breeze inspire your daily yoga practice A yoga mat that delights — a subtle design inspired by nature and surf culture makes every session a true pleasure Includes carrying strap.

Product Information

BrandMoonholi Yoga
CategoryYoga & fitness mat
MPN / SKUSKU-153
Item Group9975945199958
CurrencyEUR
CountryPL

Ships to (237 countries)

ACACADADAEAEAFAFAGAGAIAIALALAMAMAOAOARARATATAUAUAWAWAXAXAZAZBABABBBBBDBDBEBEBFBFBGBGBHBHBIBIBJBJBLBLBMBMBNBNBOBOBQBQBRBRBSBSBTBTBWBWBYBYBZBZCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCWCWCXCXCYCYCZCZDEDEDJDJDKDKDMDMDODODZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGDGDGEGEGFGFGGGGGHGHGIGIGLGLGMGMGNGNGPGPGQGQGRGRGSGSGTGTGWGWGYGYHKHKHNHNHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIO
Yoga mat WAVE RIDER BALI - natural rubber, non-slip, eco-friendly fitness, pilates and yoga mat — Bobby