Facials
Beto Beauty Salon

Facials

BHD 18.00
In StockBHBH
Style (1 variants)

Classic facial

BHD 18.00

In stock

View Now

Description

Facial Skin care treatment A facial is a family of skin care treatments for the face, including steam, exfoliation, extraction, creams, lotions, facial masks, peels, and massage Skin analysis: "The esthetician will begin by chatting with you and asking you questions so they can determine the best treatment plan for your skin, Cleanse: To create a clean canvas for all treatments to follow. Exfoliation: "This can take many different forms, but a gentle exfoliating acid or enzyme peel, ultrasonic exfoliation, microdermabrasion, or bio-brasion are the most common," notes Rouleau. Steam: To increase blood flow and make it easier for the esthetician to perform extractions. Massage: Arguably the best part of the treatment (IMO). Techniques and timing may vary, but most estheticians will perform some sort of facial massage to promote better product absorption, encourage circulation, and sculpt the facial muscles. Manual extractions: If you're facing congested skin, an esthetician might perform some extractions to clear out the clogged pores. The specific order here varies: "Unlike most estheticians, I always perform extractions after the massage," notes Rouleau, but it typically comes after the steam and exfoliation steps. Mask: Options vary, depending on your skin's needs (hydrating, pore refining, etc.).

Product Information

BrandBeto Beauty Salon
CategoryService
Item Group7427776643230
CurrencyBHD
CountryBH

Ships to (199 countries)

ACACADADAEAEALALAMAMAOAOARARATATAUAUAXAXAZAZBABABDBDBEBEBFBFBGBGBHBHBIBIBJBJBNBNBOBOBRBRBSBSBTBTBWBWBYBYCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCXCXCYCYCZCZDEDEDJDJDKDKDMDMDZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGEGEGFGFGGGGGHGHGIGIGMGMGNGNGQGQGRGRGWGWHKHKHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIOIQIQISISITITJEJEJMJMJOJOJPJPKEKEKGKGKHKHKIKIKMKMKRKRKWKWKZKZLALALBLBLILI
Facials — Bobby