(Tsuboichi) Matcha Latte Made with MilkOut of stock
Tsuboichi Tea Honpo Co. Ltd.

(Tsuboichi) Matcha Latte Made with Milk

$5.65
Out of StockUSUS
Title (1 variants)

Default Title

SKU: 4570018723414

$5.65

Out of stock

View Now

Description

(Tsuboichi) Matcha Latte Made with Milk is a package containing 80 grams of instant matcha powder and Wasanbon sugar in a re-sealable pouch. Tsuboichi Matcha Latte Made with Milk brings the authentic taste of 100% Domestic Japanese matcha into an easy, café-style drink you can enjoy anytime. This convenient 80 gram resealable pouch contains a carefully balanced instant blend of premium matcha and Japanese Wasanbon sugar, preserving freshness while making preparation effortless at home, at work, or on the go. Each cup delivers a smooth harmony of mellow sweetness, gentle matcha bitterness, and a rich, comforting aroma. Simply add hot or cold milk—to enjoy a velvety matcha latte made with milk in seconds. Perfect for a morning boost, an afternoon pause, or a relaxing evening treat, this matcha made with milk offers a soothing taste of Japan whenever you need a moment to unwind. Enjoy authentic flavor, comforting warmth, and café-quality satisfaction in every sip. Instructions: ( How to Brew). Just add hot milk (or soy milk), and you can easily enjoy an Authentic Matcha Latte Made with Milk. (One package makes about 8 cups). Cold: Put in a cup, 8 grams powder, pour 100ml cold milk (or soy milk), add ice and stir well. Hot: Add milk or (soy milk) and (8 grams) to a cup, stir, and microwave (500W) for about 1 minute. Remove the cup and mix well until ready. *Adjust the strength to your liking. Nutrition: Per cup (8g): Energy 31kcal, Protein: 0.4g, Lipid: 0.06g, Carbohydrate: 17.4g, Salt equivalent: 0.0g. Ingredients: Sugar (Sugar Beet, Domestic - Japan), Matcha, Wasanbon Sugar. Manufacturer: Tsuboichi Tea Honpo Co., Ltd., Second Factory: 4-8 Takashihamacho, Takaishi City, Osaka Prefecture , Japan. Size: Height: 18 cm. Width: 11 cm. Depth: 4.5 cm. Weight: 80 gram bag. Disclaimer: Japanese Green Tea Shops strives to display the latest product information on our site, but the product specifications ( C apacity, P ackage Design, Ingredients , C ountry of origin, etc.) may ch

Product Information

BrandTsuboichi Tea Honpo Co. Ltd.
CategoryJapanese Green Tea
MPN / SKU4570018723414
Item Group7901181575216
CurrencyUSD
CountryUS

Ships to (235 countries)

ACACADADAEAEAFAFAGAGAIAIALALAMAMAOAOARARATATAUAUAWAWAXAXAZAZBABABBBBBDBDBEBEBFBFBGBGBHBHBIBIBJBJBLBLBMBMBNBNBOBOBQBQBRBRBSBSBTBTBWBWBYBYBZBZCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCWCWCXCXCYCYCZCZDEDEDJDJDKDKDMDMDODODZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGDGDGEGEGFGFGGGGGHGHGIGIGLGLGMGMGNGNGPGPGQGQGRGRGSGSGTGTGWGWGYGYHKHKHNHNHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIO