Nature Secrete Serum Eclaircissant Carotte Carrot Oil 100ml
Nature Secrete

Nature Secrete Serum Eclaircissant Carotte Carrot Oil 100ml

BHD 3.60
In StockBHBH
Title (1 variants)

Default Title

SKU: 00000001419

BHD 3.60

In stock

View Now

Description

Nature Secrete Serum Eclaircissant Carotte Carrot Oil Always Beautiful. This Serum contains an extract of snail slime that restores skin balance, enriched with pure argan oil, the enzyme Q10, Lightening serum anti aging Nature Secrete treats acne,wrinkles, scars, stretch marks, it restores skin elasticity and rejects dea skin. It reduces cellular damage responsible for premature aging of your skin Nature Secrete with pure argan oil purifies your skin toxins, making it more flexible, soft as silk, super smooth your complexion is uniform and bright, unblemished. Size: 100ml, Gender: Unisex, Ingredient: Argan Oil, Brand: Nature Secrete, Formulation: Serum, Skin Type: All Skin Types Nature Secret Serum Eclaircissant Carotte Carrot Oil 100ml Brand: Nature Secrete Size: 100ml Gender: Unisex Ingredient: Argan Oil Formulation: Serum Skin Type: All Skin Types

Product Information

BrandNature Secrete
CategorySerum
MPN / SKU00000001419
Item Group7536883269790
CurrencyBHD
CountryBH

Ships to (199 countries)

ACACADADAEAEALALAMAMAOAOARARATATAUAUAXAXAZAZBABABDBDBEBEBFBFBGBGBHBHBIBIBJBJBNBNBOBOBRBRBSBSBTBTBWBWBYBYCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCXCXCYCYCZCZDEDEDJDJDKDKDMDMDZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGEGEGFGFGGGGGHGHGIGIGMGMGNGNGQGQGRGRGWGWHKHKHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIOIQIQISISITITJEJEJMJMJOJOJPJPKEKEKGKGKHKHKIKIKMKMKRKRKWKWKZKZLALALBLBLILI