Shea Moisture Coconut & Hibiscus Curl Masque 13oz-29% off
Shea Moisture

Shea Moisture Coconut & Hibiscus Curl Masque 13oz

BHD 7.20BHD 10.20Save BHD 3.00
In StockBHBH
Title (1 variants)

Default Title

SKU: 764302291084

BHD 7.20

In stock

View Now

Description

Full Product Description SheaMoisture Shine Hair Products - Coconut & Hibiscus Curl & Shine Hair Masque The best conditioning for natural hair requires using products that enrobe hair strands in quality butters and oils, especially when you want to give hair a protein boost. Our deep treatment masque is one of our highly rated hair aids that provide nourishing hydration and instant, brilliant shine to your curls. It is also acts as a SheaMoisture curly hair masque treatment that defends against frizz, giving your hair improved definition by enhancing your already beautiful natural curls. Blended with Fair Trade & Organic Shea Butter, Coconut Oil and Silk Protein to deeply moisturize, soften and smooth dry hair cuticles for envious bouncy, beautiful curls. Hair follicles also benefit from the addition of nourishing Coconut Milk and Argan oil. Lastly, Hibiscus Oil helps keep your scalp healthy and nourished. Product Details SheaMoisture is dedicated to maintaining the accuracy of the ingredient lists on this website. However, because raw ingredients listings are subject to change due to INCI, we cannot guarantee that these lists are complete, up-to-date and/or error-free. For an accurate listing of ingredients in each product, please refer to your product packaging. Usage Instructions Section clean, wet hair. Apply generously. Use a wide tooth comb to distribute evenly from root to ends. Pay particular attention to hair ends. Leave in 5 minutes. Rinse thoroughly. For deep penetrating treatment, cover hair with a plastic cap and apply moderate heat for up to 30 minutes. Rinse thoroughly. Style as desired. When using a hair steamer do not cover hair, moist heat will add to masque‰۪s hydration. Ingredients Water, Cetearyl Alcohol, Caprylic/Capric Triglyceride, Glycerin (Vegetable), Butyrospermum Parkii (Shea) Butter*‰ª´, Stearyl Alcohol, Cetyl Alcohol, Behentrimonium Methosulfate, Cocos Nucifera (Coconut) Oil, Panthenol, Behentrimonium Chloride, Cocos Nucifera (Coconut)

Product Information

BrandShea Moisture
CategoryHair Masque
MPN / SKU764302291084
Item Group6594211971230
CurrencyBHD
CountryBH

Ships to (199 countries)

ACACADADAEAEALALAMAMAOAOARARATATAUAUAXAXAZAZBABABDBDBEBEBFBFBGBGBHBHBIBIBJBJBNBNBOBOBRBRBSBSBTBTBWBWBYBYCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCXCXCYCYCZCZDEDEDJDJDKDKDMDMDZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGEGEGFGFGGGGGHGHGIGIGMGMGNGNGQGQGRGRGWGWHKHKHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIOIQIQISISITITJEJEJMJMJOJOJPJPKEKEKGKGKHKHKIKIKMKMKRKRKWKWKZKZLALALBLBLILI
Shea Moisture Coconut & Hibiscus Curl Masque 13oz — Bobby