Mielle Pomegranate & Honey Moisturizing and Detangling Shampoo
Mielle

Mielle Pomegranate & Honey Moisturizing and Detangling Shampoo

BHD 10.80
In StockBHBH
Title (1 variants)

Default Title

SKU: 850001265409

BHD 10.80

In stock

View Now

Description

Finally, the healthy Type 4 hair product you’ve been looking for! • Provides silky slip • Pre-detangles thick, curly hair • Cleans without stripping away moisture Tackle wash day with a Type 4 hair product made just for you. Mielle’s Pomegranate & Honey Moisturizing and Detangling Shampoo uses fresh ingredients like honey and babassu oil to lift dirt and oil from your hair while preserving much needed moisture. This shampoo works into a luxurious lather and has an amazing scent. Nothing works better at loosening tangles and adding slip. Follow up with our Detangling Conditioner, moisturize with our Leave-In Conditioner, and get creative with your choice of Pomegranate & Honey hair styling products. This sulfate-free shampoo is an absolute must for your healthy hair collection. 12 fl. oz. | Contains no harmful chemicals or preservatives Ingredients Water (Aqua, Eau), Sodium C14-16 Olefin Sulfonate, Cocamidopropyl Betaine, Polyquaternium-7, Disodium Cocoamphodipropionate, Cocamide Mea, Glycol Stearate, Disodium Lauryl Sulfosuccinate, Fragrance, Honey, Peg-150 Distearate, Panthenol, Hydrolyzed Wheat Protein, Punica Granatum (Pomegranate) Seed Oil, Euterpe Oleracea Fruit Extract, Glycerin, Silk Protein, Orbignya Oleifera (Babassu) Oil, Mauritia Flexuosa (Buriti) Fruit Oil, Copaiferi Officinalis (Balsam Copaiba), Astrocaryum Murumuru Seed Butter, Sodium Chloride, Citric Acid, Phenoxyethanol, Benzoic Acid, Ethylhexylglycerin, Glycereth-2 Cocoate How to use CLEANSE Apply a generous amount onto hands and massage into wet hair and scalp until it lathers. Gently finger-comb to pre-detangle. Rinse with warm water. Repeat as necessary. Follow with our Pomegranate & Honey Moisturizing and Detangling Conditioner. PRIME Wet hair with Pomegranate & Honey Leave-In Conditioner before styling. DEFINE Finish with one of our three Pomegranate & Honey stylers.

Product Information

BrandMielle
CategoryShampoo
MPN / SKU850001265409
Item Group7274522247326
CurrencyBHD
CountryBH

Ships to (199 countries)

ACACADADAEAEALALAMAMAOAOARARATATAUAUAXAXAZAZBABABDBDBEBEBFBFBGBGBHBHBIBIBJBJBNBNBOBOBRBRBSBSBTBTBWBWBYBYCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCXCXCYCYCZCZDEDEDJDJDKDKDMDMDZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGEGEGFGFGGGGGHGHGIGIGMGMGNGNGQGQGRGRGWGWHKHKHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIOIQIQISISITITJEJEJMJMJOJOJPJPKEKEKGKGKHKHKIKIKMKMKRKRKWKWKZKZLALALBLBLILI
Mielle Pomegranate & Honey Moisturizing and Detangling Shampoo — Bobby