Wild - Zebra (CjS-175) Etched Nail Art Stamping Plate
Clear Jelly Stamper

Wild - Zebra (CjS-175) Etched Nail Art Stamping Plate

$14.95
In StockCACA
Title (1 variants)

Default Title

SKU: 2175

$14.95

In stock

View Now

Description

Clear Jelly Stamper layered stamping plates are the best on the market. We don't just send you a stamping plate...

Here's what you get with this plate!

  • 14.5cm x 9.5cm Premium quality layered stamping plate PACKED FULL of custom curated designs
  • Inspiration Colored Spec Sheet
  • Premium Backing 

Wild - Zebra by Clear Jelly Stamper

The CJS-175 Wild Kingdom - Zebra steel nail art stamping plate by Clear Jelly Stamper is a fantastic addition to any nail artist's collection. This innovative stamping plate is specifically designed to help you create striking and eye-catching zebra-themed nail art designs effortlessly.

This stamping plate is a celebration of all things zebra. It features a wide variety of zebra-inspired patterns, from classic zebra stripes to intricate zebra in unique positions. Whether you prefer a minimalist zebra print or a more elaborate zebra-inspired motif, this plate has you covered. You can truly "show us your stripes." It allows you to unleash your creativity and experiment with different zebra patterns, colors, and styles to create unique nail art that reflects your style and imagination.

With phrases such as " there is something about ." or "Who doesn't love Zebras" you can add a touch of fun to your wild manicure!

Product Information

BrandClear Jelly Stamper
CategoryLarge (14x9)
MPN / SKU2175
Item Group4524435865698
CurrencyUSD
CountryCA

Ships to (130 countries)

AEAEAGAGAIAIAOAOARARATATAUAUAWAWBEBEBGBGBMBMBNBNBOBOBRBRBSBSBWBWBYBYBZBZCACACHCHCICICLCLCNCNCOCOCRCRCVCVCWCWCYCYCZCZDEDEDKDKDMDMDODOECECEEEEEGEGERERESESETETFIFIFJFJFRFRGBGBGDGDGFGFGHGHGIGIGPGPGQGQGRGRGTGTGYGYHKHKHNHNHRHRHTHTHUHUIDIDIEIEILILIMIMININIQIQISISITITJEJEJMJMJOJOJPJPKEKEKGKGKRKRKZKZLBLBLKLKLRLRLTLTLVLVMQMQMSMSMTMTMUMUMWMWMXMXMYMYMZMZNANANCNCNGNGNININLNLNONONZNZOMOMPAPAPEPEPHPHPKPKPLPLPTPT