Massage Candle
COAXcopenhagen.com

Massage Candle

€22.00
In StockDKDK
Size (1 variants)

50 gr

SKU: BI-0374

€22.00

In stock

View Now

Description

Massage Candle - Coconut Glow Light it up and melt into the moment. This wax-free massage candle turns up the intimacy with a warm, silky oil made from skin-loving ingredients like almond, coconut, and shea butter. Once lit, it transforms into a smooth, nourishing massage oil - ready to glide over every curve of your body. Free from synthetic waxes and additives, it is gentle on skin, non-comedogenic, and safe for sensitive areas. No stickiness. No residue. Just pure, skin-softening indulgence with a mouthwatering coconut scent that lingers long after the flame dies out. Melt. Pour. Caress. The low melting point means you can pour the oil directly onto your skin without a hint of burn. Use it for full-body massages, as a luxe body moisturizer, or even add it to your bath for a sensual soak. A little goes a long way, making each session feel like a ritual worth repeating. DETAILS & FEATURES Wax-free formula made with natural oils Safe for all skin types, including sensitive Melts quickly into silky massage oil Non-comedogenic - no pore clogging Sweet coconut scent Allergy Disclaimer: Contains almond oil. If you have a nut allergy, perform a patch test before use. Ingredients: Prunus Amygdalus Dulcis Oil, Cocos Nucifera Oil, Stearic Acid, Butyrospermum Parkii Butter, Aroma, Glycine Soja Oil, Squalene, Glyceryl Stearate SE, Tocopherol, Beta-Sitosterol.

Product Information

BrandCOAXcopenhagen.com
CategoryBrand:Bijoux Indiscrets
MPN / SKUBI-0374
Item Group8915349406022
CurrencyEUR
CountryDK

Ships to (235 countries)

ADADAEAEAFAFAGAGAIAIALALAMAMAOAOARARATATAUAUAWAWAXAXAZAZBABABBBBBDBDBEBEBFBFBGBGBHBHBIBIBJBJBLBLBMBMBNBNBOBOBQBQBRBRBSBSBTBTBWBWBYBYBZBZCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCWCWCXCXCYCYCZCZDEDEDJDJDKDKDMDMDODODZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGDGDGEGEGFGFGGGGGHGHGIGIGLGLGMGMGNGNGPGPGQGQGRGRGSGSGTGTGWGWGYGYHKHKHNHNHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIOIQIQ
Massage Candle — Bobby