(Kahisakan) Otaru Coffee House Minatomachi BlendOut of stock
Kahisakan Co. Ltd.

(Kahisakan) Otaru Coffee House Minatomachi Blend

$4.01
Out of StockUSUS
Title (1 variants)

Default Title

SKU: 4971930006959

$4.01

In stock

View Now

Description

(Kahisakan) Otaru Coffee House Minatomachi Blend is a box containing 5 individually wrapped single serving Premium Quality "Drip type" coffee filter packets. Otaru Coffee House Minatomachi Blend offers a refined and comforting drip coffee experience, inspired by the port town atmosphere of Otaru, Hokkaido. This beautifully presented black, gold, and silver box contains five individually wrapped, single-serve premium drip coffee filter packets, ensuring effortless brewing and lasting freshness. Roasted in Otaru using a deep-roast profile, this blend achieves an elegant balance of bright acidity and gentle bitterness. Each cup reveals a mellow sweetness with notes of roasted nuts and caramel, followed by a smooth, soothing finish and a delicately lingering aroma. Crafted from carefully selected coffee beans sourced from Ethiopia and Brazil, the Minatomachi Blend reflects Kahisakan’s dedication to quality roasting and harmonious flavor. Ideal for relaxed moments, daily enjoyment, or as a tasteful gift for coffee enthusiasts. Sweetness: ★★1/2☆☆ Acidity: ★★★☆☆ Bitterness: ★★★☆☆ Body: ★★★☆☆ Aroma: ★★1/2☆☆ Instructions: (How to Brew). Follow these simple steps to "Drip Brew" (Kahisakan) Otaru Coffee House Minatomachi Blend. 1. Tear open the package of Individual Single cup Packages. 2. Open the Individual package and remove the filter packet of Coffee. 3. Tear along the dotted line and remove the top of the Packet. 4. Place and Fold the Holder Handles over the edges of your cup. 5. Carefully pour hot water over the Coffee Grounds a little at a time. 6. Fill the Coffee Cup near to the rim of the cup. 7. When the Filter Packet is removed, the level in the cup will go down. You can also visit our " Brewing Drip Coffee Packets " page for complete instructions with pictures. Nutrition: (Serving Size 7g extracted in about 140ml Boiling water), Calorie : 3kcal, Protein 0.1g, Fat 0g, Carbohydrate 0.6g, Sodium 0g. Ingredients: Coffee Beans (Ground Beans: Brazil, Ethiopia, etc). Man

Product Information

BrandKahisakan Co. Ltd.
CategoryGround Coffee
MPN / SKU4971930006959
Item Group7868580462640
CurrencyUSD
CountryUS

Ships to (235 countries)

ACACADADAEAEAFAFAGAGAIAIALALAMAMAOAOARARATATAUAUAWAWAXAXAZAZBABABBBBBDBDBEBEBFBFBGBGBHBHBIBIBJBJBLBLBMBMBNBNBOBOBQBQBRBRBSBSBTBTBWBWBYBYBZBZCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCWCWCXCXCYCYCZCZDEDEDJDJDKDKDMDMDODODZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGDGDGEGEGFGFGGGGGHGHGIGIGLGLGMGMGNGNGPGPGQGQGRGRGSGSGTGTGWGWGYGYHKHKHNHNHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIO
(Kahisakan) Otaru Coffee House Minatomachi Blend — Bobby