Yoga mat and yoga mat bag set - LOVEOut of stock
Moonholi Yoga

Yoga mat and yoga mat bag set - LOVE

€185.00
Out of StockPLPL
Title (1 variants)

Default Title

€185.00

Out of stock

View Now

Description

Yoga mat set Love Save up 20 EUR when buying a set The Love non-slip rubber yoga mat is our interpretation of love. And love is... all around. Love between lovers, parental love, friendship, love for Mother nature, self-love. We tried to make this non-slip yoga mat include symbols to reflect all the types of love out there. It is believed that love is the most powerful vibration in the Universe. The main graphic motif of the Love yoga mat is the heart, which appears in various forms. The yoga mat has a feel of a "love letter" where ribbons, birds facing each other, and decorative typography often appear. Lollipops, gummy bears and caring hands symbolize unconditional parental love, and the pink color of the Love yoga mat is as sweet as a candy store. Heart-shaped strawberries symbolize passion and nature. The Love non-slip yoga mat , like all Moonholi yoga mats , is also full of cosmic references, as love is the highest vibration in the Universe. We hope you LOVE it. Includes carrying strap. Yoga Mat Bag MOONWALK Universe An ideal and stylish way to carry your yoga mat around. We have designed our Moonwalk yoga mat bags for your ultimate comfort. It is made of strong, durable material to last long and protect all your belongings, with convenient inside pockets to easily locate your water bottle, mobile phone or home keys. It will fit all you need to take with you, including your yoga mat, yoga clothes and personal items, and its truly unique design will make you stand out from the crowd wherever you take it. You can also pair it with a Moonholi UNIVERSE yoga mat to create a matching look. Ideal to carry your yoga mat to class or beach Fits all yoga essentials Includes handy pockets for water bottle or mobile phone Matches Moonholi yoga mats designs so you can pair it with your Moonholi yoga mat See yoga sets . See yoga mats .

Product Information

BrandMoonholi Yoga
CategoryYoga & fitness mat
Item Group9135495283030
CurrencyEUR
CountryPL

Ships to (237 countries)

ACACADADAEAEAFAFAGAGAIAIALALAMAMAOAOARARATATAUAUAWAWAXAXAZAZBABABBBBBDBDBEBEBFBFBGBGBHBHBIBIBJBJBLBLBMBMBNBNBOBOBQBQBRBRBSBSBTBTBWBWBYBYBZBZCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCWCWCXCXCYCYCZCZDEDEDJDJDKDKDMDMDODODZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGDGDGEGEGFGFGGGGGHGHGIGIGLGLGMGMGNGNGPGPGQGQGRGRGSGSGTGTGWGWGYGYHKHKHNHNHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIO