Simple soothing facial toner 100% alcohol free
Simple

Simple soothing facial toner 100% alcohol free

BHD 4.20
In StockBHBH
Title (1 variants)

Default Title

SKU: 5011451103856

BHD 4.20

In stock

View Now

Description

Our Simple Kind to Skin Soothing Facial Toner removes any alkaline residue left after cleansing, helping restore the balance to your skin's natural pH level. Great for sensitive skin. Features a special blend of Simple skin toning goodness to help keep skin toned and refreshed; this blend includes ingredients like Pro-Vitamin B5, Witch Hazel and Allantoin. This facial toner is ideal for using after your cleanser and before your moisturiser morning and night to help remove those last traces of dirt and make-up from your skin. The Soothing Facial Toner is a great way to finish any cleansing routine, not just if you're experiencing breakouts or blemishes. In fact, a toner is a skincare treatment in its own right and helps to prepare skin for your moisturiser.

Product Information

BrandSimple
CategoryBrand_Simple
MPN / SKU5011451103856
Item Group8658904318110
CurrencyBHD
CountryBH

Ships to (199 countries)

ACACADADAEAEALALAMAMAOAOARARATATAUAUAXAXAZAZBABABDBDBEBEBFBFBGBGBHBHBIBIBJBJBNBNBOBOBRBRBSBSBTBTBWBWBYBYCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCXCXCYCYCZCZDEDEDJDJDKDKDMDMDZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGEGEGFGFGGGGGHGHGIGIGMGMGNGNGQGQGRGRGWGWHKHKHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIOIQIQISISITITJEJEJMJMJOJOJPJPKEKEKGKGKHKHKIKIKMKMKRKRKWKWKZKZLALALBLBLILI
Simple soothing facial toner 100% alcohol free — Bobby