Eden BW Almond Marshmallow Therapy Leave In ConditionerOut of stock-38% off
Eden

Eden BW Almond Marshmallow Therapy Leave In Conditioner

BHD 4.80BHD 7.80Save BHD 3.00
Out of StockBHBH
Title (1 variants)

Default Title

SKU: 765591006205

BHD 4.80

Out of stock

View Now

Description

Rehab brittle hair with this protein-rich leave-in that provides softness and slip. Notice instant improvement with long-term benefits. Leave in and style as desired. Almond Marshmallow Therapy Leave In Conditioner A lightweight, refreshing conditioner made with Sweet Almond Oil and Marshmallow Root. These ingredients help to seal in moisture, promote shine, soften, and provide slip to the hair! This leave-in also nourishes the strand while strengthening hair to protect against split ends. Hair rehab in a bottle! This product is VEGAN friendly.

Product Information

BrandEden
CategoryLeave in
MPN / SKU765591006205
Item Group7279095546014
CurrencyBHD
CountryBH

Ships to (199 countries)

ACACADADAEAEALALAMAMAOAOARARATATAUAUAXAXAZAZBABABDBDBEBEBFBFBGBGBHBHBIBIBJBJBNBNBOBOBRBRBSBSBTBTBWBWBYBYCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCXCXCYCYCZCZDEDEDJDJDKDKDMDMDZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGEGEGFGFGGGGGHGHGIGIGMGMGNGNGQGQGRGRGWGWHKHKHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIOIQIQISISITITJEJEJMJMJOJOJPJPKEKEKGKGKHKHKIKIKMKMKRKRKWKWKZKZLALALBLBLILI
Eden BW Almond Marshmallow Therapy Leave In Conditioner — Bobby