Shea Moisture Jamaican Black Castor Oil Strengthen & Restore Styling LotionOut of stock
Shea Moisture

Shea Moisture Jamaican Black Castor Oil Strengthen & Restore Styling Lotion

BHD 9.60
Out of StockBHBH
Size (1 variants)

8oz

SKU: 764302215523

BHD 9.60

Out of stock

View Now

Description

Full Product Description Jamaican Castor for Hair - Jamaican Black Castor Oil Strengthen & Restore Styling Lotion This Jamaican castor oil for hair is a precious oil-based lotion that protects hair strands and follicles, while restoring moisture and lustrous shine to dull, damaged or chemically processed hair. For this formulation, we've combined Black Castor Oil in Shea Butter with fantastic results! Hair that needs hydration can receive plenty of TLC with this rich moisturizing lotion for hair. Black Castor Oil is one of the best natural oils to use for strengthening hair from within, helping it to grow in stronger and fuller. Perfect for those who regularly color, straighten, perm or heat style their hair, as well as kinky, curly or wavy natural styles. Nutrient-rich Jamaican Black Castor Oil, certified organic Shea Butter and invigorating Peppermint combine in an ultra-moisturizing formula to protect against the damaging effects of high heat styling, while increasing hair's resistance to breakage. Use regularly as part of your hair styling regimen to nourish and protect naturally wavy and curly strands during styling. Product Details SheaMoisture is dedicated to maintaining the accuracy of the ingredient lists on this website. However, because raw ingredients listings are subject to change due to INCI, we cannot guarantee that these lists are complete, up-to-date and/or error-free. For an accurate listing of ingredients in each product, please refer to your product packaging. Usage Instructions Squeeze a small amount in to hands, and apply to damp or dry hair starting from ends and working up to roots. Do not rinse out. Dry naturally or blow dry as usual. Excellent to protect hair before using heat styling tools. Ingredients Water (Aqua), Hydroxypropyl Trimonium Hydrolyzed Corn Starch, Cetearyl Alcohol, Oat Beta Glucan, Hydrolyzed Vegetable Protein PG Propyl Silanetriol, Prunus Armeniaca (Apricot) Kernel Oil, Olea Europaea (Olive) Fruit Oil, lnulin, Behentrimoni

Product Information

BrandShea Moisture
CategoryStyling Cream
MPN / SKU764302215523
Item Group6102918004894
CurrencyBHD
CountryBH

Ships to (199 countries)

ACACADADAEAEALALAMAMAOAOARARATATAUAUAXAXAZAZBABABDBDBEBEBFBFBGBGBHBHBIBIBJBJBNBNBOBOBRBRBSBSBTBTBWBWBYBYCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCXCXCYCYCZCZDEDEDJDJDKDKDMDMDZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGEGEGFGFGGGGGHGHGIGIGMGMGNGNGQGQGRGRGWGWHKHKHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIOIQIQISISITITJEJEJMJMJOJOJPJPKEKEKGKGKHKHKIKIKMKMKRKRKWKWKZKZLALALBLBLILI