Shea Moisture Coconut & Hibiscus Frizz-Free Curl Mousse 7.5oz-25% off
Shea Moisture

Shea Moisture Coconut & Hibiscus Frizz-Free Curl Mousse 7.5oz

BHD 7.20BHD 9.60Save BHD 2.40
In StockBHBH
Title (1 variants)

Default Title

SKU: 764302290612

BHD 7.20

In stock

View Now

Description

Full Product Description SheaMoisture Curl Mousse with Coconut and Hibiscus - Frizz-Free Formula Does your dry, frizzy hair keep you from flaunting your favorite hair style? With SheaMoisture's Coconut & Hibiscus Frizz-Free Curl Mousse you can freely style your hair whichever way you want, enjoying hair that stays in place, yet remains soft and manageable. This moisture-rich styling aid enhances natural curl memory and wave pattern, giving you effortless styling options for natural, flowy waves and curls and lots of definition. This SheaMoisture curl mousse is a pleasure to use because it has no sticky, crunchy or flaky residue. With just a few pumps of our moisture-rich formula, you can achieve enviously shiny curls with high impact volume and a soft finish.Perfect for managing the frizz in humid weather conditions or humid indoor environments. SheaMoisture's Coconut & Hibiscus Frizz-Free Curl Mousse is formulated with Coconut Oil, which deeply moisturizes and protects dry, brittle hair from breakage and Neem Oil, which controls frizz while adding a brilliant shine to your curls and coils. Other quality natural ingredients such as Silk Protein blended into this formula leave your hair smooth, soft and so silky, you may find it tempting to keep touching your soft locks. Certified Organic Shea Butter in our curl mousse blend provides nourishing hydration which detangles and strengthens dry, distressed, sensitive hair to make your curls stronger, healthier and enviously bouncy! This all-natural hair care styling product is your solution to beautifully styled, frizz-free hair. SheaMoisture's Coconut & Hibiscus Frizz-Free Curl Mousse is created especially for wavy, curly hair so that you have touchably soft, gorgeously defined, shining curls all the time. Product Details SheaMoisture is dedicated to maintaining the accuracy of the ingredient lists on this website. However, because raw ingredients listings are subject to change due to INCI, we cannot guarantee that these

Product Information

BrandShea Moisture
CategoryStyling Cream
MPN / SKU764302290612
Item Group6102917283998
CurrencyBHD
CountryBH

Ships to (199 countries)

ACACADADAEAEALALAMAMAOAOARARATATAUAUAXAXAZAZBABABDBDBEBEBFBFBGBGBHBHBIBIBJBJBNBNBOBOBRBRBSBSBTBTBWBWBYBYCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCXCXCYCYCZCZDEDEDJDJDKDKDMDMDZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGEGEGFGFGGGGGHGHGIGIGMGMGNGNGQGQGRGRGWGWHKHKHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIOIQIQISISITITJEJEJMJMJOJOJPJPKEKEKGKGKHKHKIKIKMKMKRKRKWKWKZKZLALALBLBLILI