Magnolia Transparent Tea Mug | Stainless Steel Infuser
Sancha Tea Boutique

Magnolia Transparent Tea Mug | Stainless Steel Infuser

β‚Ή4,049.00
In StockININ
Volume (1 variants)

300ml

SKU: 711-07938

β‚Ή4,049.00

In stock

View Now

Description

🌸 Magnolia Transparent Tea Mug with Stainless Steel Infuser Turn everyday tea drinking into a mindful ritual with the Magnolia Transparent Tea Mug , designed for effortless loose leaf brewing and serene sipping πŸƒβ˜• Crafted from durable, heat-resistant borosilicate glass , this elegant mug lets you watch your tea leaves unfurl as they steep. It comes with a removable stainless steel infuser , making it perfect for brewing loose leaf teas without any mess or hassle ✨ The fine mesh stainless steel infuser allows optimal flavour extraction while preventing even the smallest tea particles from entering your cup β€” ensuring a clean, smooth brew every time 🌿 πŸ’› Why You’ll Love It 🍡 Ideal for Loose Leaf Teas – Green, white, black, herbal & oolong πŸ”₯ Premium Borosilicate Glass – Heat-resistant, lightweight & durable πŸ«– Fine Mesh Stainless Steel Infuser – Full flavour, no residue 🧼 Easy to Brew & Easy to Clean – Removable infuser for daily convenience ♻️ Reusable & Sustainable – Brew the same tea leaves up to 3 times 🌿 How to Use Add tea leaves to the infuser, pour hot water over them, and allow the tea to steep to your preference. Remove the infuser and enjoy a beautifully brewed cup β€” calm, pure, and satisfying ✨ Make tea more than a beverage. Make it a ritual. πŸŒΌπŸƒ

Product Information

BrandSancha Tea Boutique
CategoryCoffee & Tea Cups
MPN / SKU711-07938
Item Group8814290174120
CurrencyINR
CountryIN

Ships to (237 countries)

ACACADADAEAEAFAFAGAGAIAIALALAMAMAOAOARARATATAUAUAWAWAXAXAZAZBABABBBBBDBDBEBEBFBFBGBGBHBHBIBIBJBJBLBLBMBMBNBNBOBOBQBQBRBRBSBSBTBTBWBWBYBYBZBZCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCWCWCXCXCYCYCZCZDEDEDJDJDKDKDMDMDODODZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGDGDGEGEGFGFGGGGGHGHGIGIGLGLGMGMGNGNGPGPGQGQGRGRGSGSGTGTGWGWGYGYHKHKHNHNHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIO