Shea Moisture Low Porosity Hydrating Conditioner 384 ml
Shea Moisture

Shea Moisture Low Porosity Hydrating Conditioner 384 ml

BHD 9.60
In StockBHBH
Title (1 variants)

Default Title

SKU: 764302020721

BHD 9.60

In stock

View Now

Description

Shea Moisture Low Porosity Weightless Hydrating Conditioner with Grapeseed & Tea Tree Oils 384 ml Shea Moisture Low Porosity Weightless Hydrating Conditioner is a lightweight, hydrating conditioner that softens and conditions moisture resistant, low porosity hair without surface build-up Formulated with Grapeseed, Tea Tree and Sunflower Oils, and Fair Trade Shea Butter, this lightweight conditioner is ideal for low-porosity, protein-sensitive and moisture-resistant curls and coils This hair conditioner improves manageability for low-porosity and protein-sensitive curls and coils Apply conditioner to wet hair, leave in for 3 minutes and rinse thoroughly. For best results, apply our Low Porosity Weightless Hydrating Shampoo first and Detangler after conditioning. Tested on our family and friends for generations, and never on animals This hair conditioner is formulated with no parabens, no phthalates, no mineral oil, no animal testing, and no petrolatum

Product Information

BrandShea Moisture
CategoryConditioner
MPN / SKU764302020721
Item Group8101601214622
CurrencyBHD
CountryBH

Ships to (199 countries)

ACACADADAEAEALALAMAMAOAOARARATATAUAUAXAXAZAZBABABDBDBEBEBFBFBGBGBHBHBIBIBJBJBNBNBOBOBRBRBSBSBTBTBWBWBYBYCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCXCXCYCYCZCZDEDEDJDJDKDKDMDMDZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGEGEGFGFGGGGGHGHGIGIGMGMGNGNGQGQGRGRGWGWHKHKHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIOIQIQISISITITJEJEJMJMJOJOJPJPKEKEKGKGKHKHKIKIKMKMKRKRKWKWKZKZLALALBLBLILI