Vaseline Cocoa Radiant body lotion 10oz
Vaseline

Vaseline Cocoa Radiant body lotion 10oz

BHD 4.80
In StockBHBH
Title (1 variants)

Default Title

SKU: 305210134416

BHD 4.80

In stock

View Now

Description

Made with Pure Cocoa Butter and Ultra-Hydrating Lipids, Vaseline Intensive Care Cocoa Radiant Lotion prevents dryness and helps keep your skin looking healthy and hydrated. With daily exposure to environmental triggers (like wind, lack of humidity, and sun), skins natural moisture barrier can break down, allowing water to escape the skin. But the Ultra-Hydrating lipids in our Cocoa Radiant lotion fortify the skin barrier and replenish moisture to allow the skins natural barrier to recover. Vaseline Intensive Care Cocoa Radiant Lotion for dry skin, formulated with Ultra-Hydrating Lipids and Pure Cocoa Butter, moisturizes skin for a long-lasting, radiant glow. This body moisturizer is clinically tested to provide 90% more moisture (vs. untreated skin). This body lotion for dry skin absorbs fast for rich moisturization without the residue and provides 48-hour moisture. Use this dermatologist-tested body lotion daily on dry, rough skin for stronger, noticeably healthier skin. Just apply to your skin for long-lasting moisture. This lotion bottle is made of 50% recycled plastic. Our Intensive Care range works to heal dry skin from deep within. Explore the range of Vaseline products, including Vaseline lotion, and enjoy the healing power of Vaseline. Vaseline has a range of products to help heal, soothe, and moisturize all skin. We believe skin health is essential for well-being. Thats why Vaseline is working towards giving everybody, everywhere, access to the skin care they need.

Product Information

BrandVaseline
CategoryLotion
MPN / SKU305210134416
Item Group8268815663262
CurrencyBHD
CountryBH

Ships to (199 countries)

ACACADADAEAEALALAMAMAOAOARARATATAUAUAXAXAZAZBABABDBDBEBEBFBFBGBGBHBHBIBIBJBJBNBNBOBOBRBRBSBSBTBTBWBWBYBYCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCXCXCYCYCZCZDEDEDJDJDKDKDMDMDZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGEGEGFGFGGGGGHGHGIGIGMGMGNGNGQGQGRGRGWGWHKHKHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIOIQIQISISITITJEJEJMJMJOJOJPJPKEKEKGKGKHKHKIKIKMKMKRKRKWKWKZKZLALALBLBLILI
Vaseline Cocoa Radiant body lotion 10oz — Bobby