As I Am Naturally 3pcs Combo Deal (Curl Shampoo, Leave-In Conditioner and Co Wash)Out of stock-11% off
As I am

As I Am Naturally 3pcs Combo Deal (Curl Shampoo, Leave-In Conditioner and Co Wash)

BHD 24.00BHD 27.00Save BHD 3.00
Out of StockBHBH
Title (1 variants)

Default Title

SKU: Set

BHD 24.00

Out of stock

View Now

Description

At times your coils or curls just won't act right and it's difficult to make them shine and behave. These are the tell signs that it's time to remove the old, dulling residue and make a fresh clean start, but without dehydrating your hair. ///// This natural wonder keeps tangles away and provides a great foundation for natural styling. It contains an organic strengthening agent, plus natural ingredients that promote hair growth. ///// Rich consistency. Economical to use. A small amount does the job. Moisturizes and promotes shine. Helps strengthen hair and repair damaged areas. Contains an wide array of natural ingredients known for hydrating and nourishing hairAs I Am Naturally 3pcs Combo Deal (Curl Shampoo, Leave-In Conditioner and Detangling Conditioner)

Product Information

BrandAs I am
CategoryCombo
MPN / SKUSet
Item Group6734940471454
CurrencyBHD
CountryBH

Ships to (199 countries)

ACACADADAEAEALALAMAMAOAOARARATATAUAUAXAXAZAZBABABDBDBEBEBFBFBGBGBHBHBIBIBJBJBNBNBOBOBRBRBSBSBTBTBWBWBYBYCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCXCXCYCYCZCZDEDEDJDJDKDKDMDMDZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGEGEGFGFGGGGGHGHGIGIGMGMGNGNGQGQGRGRGWGWHKHKHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIOIQIQISISITITJEJEJMJMJOJOJPJPKEKEKGKGKHKHKIKIKMKMKRKRKWKWKZKZLALALBLBLILI