Yoga mat and yoga mat bag set - COSMIC GIRLOut of stock
Moonholi Yoga

Yoga mat and yoga mat bag set - COSMIC GIRL

€185.00
Out of StockPLPL
Title (1 variants)

Default Title

SKU: SKU-107-1

€185.00

Out of stock

View Now

Description

Yoga mat set Cosmic Girl Save up 20 EUR when buying a set Your mat. Your space. Your cosmos. Cosmic Girl was created for those who see their practice as a journey — sometimes as calm as drifting through space, sometimes as powerful as a rocket launch. Natural rubber provides a stable, non-slip base that keeps the mat firmly in place, no matter the pace of your practice. The soft premium microfiber surface activates grip with movement and moisture, offering confidence in every asana. The 3 mm thickness allows you to stay connected to the ground and maintain full control of your body, while still supporting joint comfort. The purple, galactic design inspired by cosmic energy turns every practice into a ritual — a moment to step beyond the everyday and return to yourself. Features that keep you in orbit: natural rubber with high grip non-slip backing for maximum stability premium microfiber — perfect for both dynamic and gentle practices dimensions: 183 × 61 cm thickness: 3 mm Unroll your mat, take a breath, and allow yourself to flow through your own cosmic sequence. Includes carrying strap. Yoga Mat Bag MOONWALK Cosmic Girl An ideal and stylish way to carry your yoga mat around. We have designed our Moonwalk yoga mat bags for your ultimate comfort. It is made of strong, durable material to last long and protect all your belongings, with convenient inside pockets to easily locate your water bottle, mobile phone or home keys. It will fit all you need to take with you, including your yoga mat, yoga clothes and personal items, and its truly unique design will make you stand out from the crowd wherever you take it. You can also pair it with a Moonholi COSMIC GIRL yoga mat to create a matching look. Ideal to carry your yoga mat to class or beach Fits all yoga essentials Includes handy pockets for water bottle or mobile phone Matches Moonholi yoga mats designs so you can pair it with your Moonholi yoga mat See other yoga sets . See yoga mats .

Product Information

BrandMoonholi Yoga
CategoryYoga & fitness mat
MPN / SKUSKU-107-1
Item Group6997185265837
CurrencyEUR
CountryPL

Ships to (237 countries)

ACACADADAEAEAFAFAGAGAIAIALALAMAMAOAOARARATATAUAUAWAWAXAXAZAZBABABBBBBDBDBEBEBFBFBGBGBHBHBIBIBJBJBLBLBMBMBNBNBOBOBQBQBRBRBSBSBTBTBWBWBYBYBZBZCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCWCWCXCXCYCYCZCZDEDEDJDJDKDKDMDMDODODZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGDGDGEGEGFGFGGGGGHGHGIGIGLGLGMGMGNGNGPGPGQGQGRGRGSGSGTGTGWGWGYGYHKHKHNHNHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIO