Shea Moisture Coconut Hibiscus Curl & Shine Conditioner-25% off
Shea Moisture

Shea Moisture Coconut Hibiscus Curl & Shine Conditioner

BHD 7.20BHD 9.60Save BHD 2.40
In StockBHBH
Size (1 variants)

13oz

SKU: 764302290629

BHD 7.20

In stock

View Now

Description

Full Product Description SheaMoisture Coconut and Hibiscus Conditioner Give your hair a smooth and shiny finish by conditioning your hair with SheaMoisture's Coconut & Hibiscus Curl and Shine Conditioner. As part of our line of silicone-free conditioners, this all-natural hair care product is the perfect partner for our SheaMoisture Coconut & Hibiscus Shampoo. It's formulated for those who have wavy to kinky curls, and it's especially great for thick hair, and as soon its creamy richness is applied after shampooing, this conditioner instantly softens and detangles dry, frizzy hair while infusing your curls and coils with intense moisture and shine-enhancing nutrients. Consistently rated as one of the best products for curly hair, this intense hydration hair treatment is formulated using natural ingredients like Coconut and Neem oil to deeply moisturize dry hair and control frizz while protecting your waves or curls from breakage. Natural Ingredients like Silk Protein is blended into this formula to leave your hair smooth, soft, and silky while enhancing your curls with natural shine. Certified Organic Shea Butter provides nourishing hydration to dry, damaged and over-processed hair which helps in detangling curls. Overall, this Hibiscus-enhanced formula offers a simple way to make your wash n' go hairstyles easier to manage, whether you use this conditioner as a shampoo follow-up or as a co-wash. SheaMoisture's Coconut & Hibiscus Curl and shine Conditioner is an all-natural, lightweight hair care formula that restores and smooths dry hair without weighing your hair down. This moisturizing shine conditioner ensures you have no more knots, snarls or tangles - just soft, shining, easy-to-style hair wash after every wash. Product Details SheaMoisture is dedicated to maintaining the accuracy of the ingredient lists on this website. However, because raw ingredients listings are subject to change due to INCI, we cannot guarantee that these lists are complete, up-to-date an

Product Information

BrandShea Moisture
CategoryConditioner
MPN / SKU764302290629
Item Group6102917513374
CurrencyBHD
CountryBH

Ships to (199 countries)

ACACADADAEAEALALAMAMAOAOARARATATAUAUAXAXAZAZBABABDBDBEBEBFBFBGBGBHBHBIBIBJBJBNBNBOBOBRBRBSBSBTBTBWBWBYBYCACACCCCCDCDCFCFCGCGCHCHCICICKCKCLCLCMCMCNCNCOCOCRCRCVCVCXCXCYCYCZCZDEDEDJDJDKDKDMDMDZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGEGEGFGFGGGGGHGHGIGIGMGMGNGNGQGQGRGRGWGWHKHKHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIOIQIQISISITITJEJEJMJMJOJOJPJPKEKEKGKGKHKHKIKIKMKMKRKRKWKWKZKZLALALBLBLILI
Shea Moisture Coconut Hibiscus Curl & Shine Conditioner — Bobby