Ornamental Skull Yoga Pants
GearBunch

Ornamental Skull Yoga Pants

$93.99
In StockAUAU
Size (5 variants)

XS

Color: Black

SKU: 6521916

$93.99

In stock

S

Color: Black

SKU: 3928141

$93.99

In stock

M

Color: Black

SKU: 3884970

$93.99

In stock

L

Color: Black

SKU: 5046283

$93.99

In stock

XL

Color: Black

SKU: 3670578

$93.99

In stock

View Now

Description

Embrace the artful edge with our Ornamental Skull Yoga Pants. The intricate black and white design offers a sophisticated take on a classic motif, perfect for those who appreciate a touch of gothic elegance in their activewear. Wear them to yoga class, the gym, or styled with your favorite top for a uniquely bold look. Why You'll Love It The super soft fabric feels like a second skin, allowing you to move without restriction. Made from 82% polyester and 18% spandex for a comfortable and flexible fit. Our yoga pants are squat-proof, offering full coverage during any activity. Experience unrestricted movement with our 4-way stretch fabric that moves with you. The high waistband provides a secure and flattering fit that stays in place. These durable leggings are easy to care for; simply machine wash and tumble dry. The buttery-soft feel makes these your new go-to leggings for ultimate comfort. Enjoy vibrant, long-lasting print that won't fade, even after repeated washing. You Might Also Like Ornamental Skull Youth Leggings Ornamental Skull Yoga Capris Ornamental Skull Sports Bra

Product Information

BrandGearBunch
CategoryYoga Pants
MPN / SKU6521916
Item Group1485558513699
CurrencyUSD
CountryAU

Ships to (209 countries)

ADADAEAEAFAFAGAGAIAIALALAMAMAOAOARARATATAUAUAWAWAXAXAZAZBABABBBBBDBDBEBEBFBFBGBGBHBHBLBLBMBMBNBNBQBQBRBRBSBSBTBTBVBVBYBYBZBZCACACCCCCDCDCFCFCHCHCICICKCKCLCLCMCMCOCOCRCRCVCVCWCWCXCXCYCYCZCZDEDEDKDKDMDMDODODZDZECECEEEEEGEGEHEHERERESESETETFIFIFJFJFKFKFOFOFRFRGAGAGBGBGDGDGEGEGFGFGGGGGHGHGIGIGLGLGNGNGPGPGQGQGRGRGSGSGTGTGYGYHKHKHMHMHNHNHRHRHTHTHUHUIDIDIEIEILILIMIMININIOIOISISITITJEJEJMJMJOJOJPJPKEKEKHKH
Ornamental Skull Yoga Pants — Bobby